Recently, I received a fasta format sequence file from one of my colleges, But there are some strange characters like ^? in the sequence , does anyone knows why and how can I delete these characters? Because there are a lot of ^? in sequences and I don't want to delete manually.
I tried to recognize these characters using vim by \^\? , ^? or \^? but failed. Since the data is output of MEGA maybe there is some reasons in there.
The sequence is like this:
^?MRATGEKRVLQLHELDEFCLDSYENAKIYKEKTERWHNRHIREKEIEVGQQVLMFNSHLKLFSGKLKSRWSGSFTVVAVFPHSKLERIAEDLLIE
what is the output of
file your.fasta
must be : ASCII test
apart from Pierre Lindenbaum remark, does the file contain the typical fasta header lines (starting with > followed by some text denoting the sequence ID/name) ?
Thanks, I think it is encoding problem.
If an answer was helpful you should upvote it, if the answer resolved your question you should mark it as accepted.
Log in to answer this question.
