Is there any software/online tools to find N terminal and C terminal of a protein
0 answers
No answers yet.
Log in to answer this question.
More posts like this
-
protein interaction prediction
written by Fatemeh 5Hi everyone, I am wondering if there is a possibility to predict the protein interactions and finding possible targets for an specific protein of interest …
-
Calculating emPAI using protein pilot data
written by ihedy.m 0Hi everyone. I want to calculate protein abundance index (PAI) and then emPAI for my peptides. I know the formula is N observed divided by …
-
Determination of N-terminal and C-terminal of a protein experimentally
written by zhongjixx 0Hi everyone, I don't know much about protein so I am hoping that you guys can give me some advice on how to determination of …
-
How to determine the c-terminal and n-terminal regions of a proteome of a non-model organism?
written by euduca 1Hello everyone, I have come for some time looking for some way to determine (using bioinformatics) the c-terminal and n-terminal regions of a non-model organisms …
-
How to find the C-terminal & N-terminal amino acid
written by Naresh 6Hi, I am interested to find the amino acid which are present in N-terminal & C-terminal of a protein sequence.
-
Trying to build phylogenetic tree represented by atoms
written by Naresh 6Hi, I am trying to build a phylogenetic tree to represent atoms like C, N, S, O, H. I want to compare it and create …
-
can we visualize protein molecule on its actual basis . i.e. atomic level..
written by Naresh 6Hi, Is it feasible to visualize protein molecule in its atomic level (C,O,N,H,S) in order to solve protein folding problem..
-
makeblastdb command not found
written by linhuixinnn 0Hi, I am new to this whole command line Blast+ Suite. Sorry for sounding dumb but I couldnt find useful help sheet online. I am …
-
Is protein structure prediction with low query coverage an appropriate method?
written by evo_genomics 6I am studying the evolutionary aspect of gene family. I want to build the structure of each family member and want to estimate, how much …
-
Detecting Terminals In Protein Structures
written by Reyhaneh 53<p>Hi </p> <p>I want to detect C-terminals and N-terminals in a set of protein PDB files. The loop structure (with no helical/sheet secondary structure) at …
What sort of input do you have...
Hello Naresh!
Questions similar to yours can already be found at:
We have closed your question to allow us to keep similar content in the same thread.
If you disagree with this please tell us why in a reply below. We'll be happy to talk about it.
Cheers!
I strongly disagree. I am asking questions in Biostars because you people are more experienced and have vast knowledge. You need to answer or give convincing answers to me rather than closing if you find similar question before.
You need to give enough information for us to answer the questions. You've asked this same question before and gotten replies asking for additional context, so provide that.
suppose i have a FAM72A protein of 149 aa. I know from where N terminal starts, but i don't know where N terminal ends and also i don't know from where C terminal starts and ends in that protein. Please let me know.
Dude, you are confused. May be first you get your question right. Protein is made by reading mRNA in the 5' to 3' direction and making new protein from its amino end (N-terminus) towards its carboxyl end (C-terminus). so In your case, 1st amino acid would have N terminal and 149th would have C-terminal. I think that wikipedia would be more helpful for you than biostar
Please consult an undergraduate biology text book. A basic understanding of biological terms will go a long way.
MFKCWSVVLVLGFIFLESEGRPTKEGGYGLKSYQPLMRLRHKQEKNQESSRVKGFMIQDGPFGSCE NKYCGLGRHCVTSRETGQAECACMDLCKRHYKPVCGSDGEFYENHCEVHRAACLKKQKITIVHNED CFFKGDKCKTTEYSKMKNMLLDLQNQKYIMQENENPNGDDISRKKLLVDQMFKYFDADSNGLVDIN ELTQVIKQEELGKDLFDCTLYVLLKYDDFNADKHLALEEFYRAFQVIQLSLPEDQKLSITAATVGQ SAVLSCAIQGTLRPPIIWKRNNIILNNLDLEDINDFGDDGSLYITKVTTTHVGNYTCYADGYEQVY QTHIFQVNVPPVIRVYPESQAREPGVTASLRCHAEGIPKPQLGWLKNGIDITPKLSKQLTLQANGS EVHISNVRYEDTGAYTCIAKNEAGVDEDISSLFVEDSARKTLANILWREEGLGIGNMFYVFYEDGI KVIQPIECEFQRHIKPSEKLLGFQDEVCPKAEGDEVQRCVWASAVNVKDKFIYVAQPTLDRVLIVD VQSQKVVQAVSTDPVPVKLHYDKSHDQVWVLSWGTLEKTSPTLQVITLASGNVPHHTIHTQPVGKQ FDRVDDFFIPTTTLIITHMRFGFILHKDEAALQKIDLETMSYIKTINLKDYKCVPQSLAYTHLGGY YFIGCKPDSTGAVSPQVMVDGVTDSVIGFNSDVTGTPYVSPDGHYLVSINDVKGLVRVQYITIRGE IQEAFDIYTNLHISDLAFQPSFTEAHQYNIYGSSSTQTDVLFVELSSGKVKMIKSLKEPLKAEEWP WNRKNRQIQDSGLFGQYLMTPSKDSLFILDGRLNKLNCEITEVEKGNTVIWVGDA
okayyyyyy... PEPTIDE ! Am I right ? DID I WIN SOMETHING ?!!!
Follistatin-related protein 5. I award myself one internet.