This is a test version of Biostars. For the public version, visit https://www.biostars.org.
Is there any software/online tools to find N terminal and C terminal of a protein

Hi.

I am interested to find N terminal and C terminal of a protein using online tools for my designing experiments.

sequence genome

What sort of input do you have...

Hello Naresh!

Questions similar to yours can already be found at:

We have closed your question to allow us to keep similar content in the same thread.

If you disagree with this please tell us why in a reply below. We'll be happy to talk about it.

Cheers!

I strongly disagree. I am asking questions in Biostars because you people are more experienced and have vast knowledge. You need to answer or give convincing answers to me rather than closing if you find similar question before.

You need to give enough information for us to answer the questions. You've asked this same question before and gotten replies asking for additional context, so provide that.

suppose i have a FAM72A protein of 149 aa. I know from where N terminal starts, but i don't know where N terminal ends and also i don't know from where C terminal starts and ends in that protein. Please let me know.

Dude, you are confused. May be first you get your question right. Protein is made by reading mRNA in the 5' to 3' direction and making new protein from its amino end (N-terminus) towards its carboxyl end (C-terminus). so In your case, 1st amino acid would have N terminal and 149th would have C-terminal. I think that wikipedia would be more helpful for you than biostar

Please consult an undergraduate biology text book. A basic understanding of biological terms will go a long way.

MFKCWSVVLVLGFIFLESEGRPTKEGGYGLKSYQPLMRLRHKQEKNQESSRVKGFMIQDGPFGSCE NKYCGLGRHCVTSRETGQAECACMDLCKRHYKPVCGSDGEFYENHCEVHRAACLKKQKITIVHNED CFFKGDKCKTTEYSKMKNMLLDLQNQKYIMQENENPNGDDISRKKLLVDQMFKYFDADSNGLVDIN ELTQVIKQEELGKDLFDCTLYVLLKYDDFNADKHLALEEFYRAFQVIQLSLPEDQKLSITAATVGQ SAVLSCAIQGTLRPPIIWKRNNIILNNLDLEDINDFGDDGSLYITKVTTTHVGNYTCYADGYEQVY QTHIFQVNVPPVIRVYPESQAREPGVTASLRCHAEGIPKPQLGWLKNGIDITPKLSKQLTLQANGS EVHISNVRYEDTGAYTCIAKNEAGVDEDISSLFVEDSARKTLANILWREEGLGIGNMFYVFYEDGI KVIQPIECEFQRHIKPSEKLLGFQDEVCPKAEGDEVQRCVWASAVNVKDKFIYVAQPTLDRVLIVD VQSQKVVQAVSTDPVPVKLHYDKSHDQVWVLSWGTLEKTSPTLQVITLASGNVPHHTIHTQPVGKQ FDRVDDFFIPTTTLIITHMRFGFILHKDEAALQKIDLETMSYIKTINLKDYKCVPQSLAYTHLGGY YFIGCKPDSTGAVSPQVMVDGVTDSVIGFNSDVTGTPYVSPDGHYLVSINDVKGLVRVQYITIRGE IQEAFDIYTNLHISDLAFQPSFTEAHQYNIYGSSSTQTDVLFVELSSGKVKMIKSLKEPLKAEEWP WNRKNRQIQDSGLFGQYLMTPSKDSLFILDGRLNKLNCEITEVEKGNTVIWVGDA

okayyyyyy... PEPTIDE ! Am I right ? DID I WIN SOMETHING ?!!!

Follistatin-related protein 5. I award myself one internet.

0 answers

No answers yet.

Log in to answer this question.