This is a test version of Biostars. For the public version, visit https://www.biostars.org.
BLAST options error (input format type error) in makeblastdb
When I use `makeblastdb` command to build a protein database by using a fasta file, it is ok. But when combined this fasta file together <pre>makeblastdb</pre> tell me have a BLAST options error.
My BLAST+ version is 2.4.0+, computer system version is ubuntu 16.04 and the detail imformation is below.

sqreb@sqreb-Vostro-1450:~/ORF_culster/blastdb$ makeblastdb -in progbbct1.fasta -input_type fasta -dbtype prot -parse_seqids -title 'bct_protein data in genbank' 


Building a new DB, current time: 07/21/2016 16:05:51
New DB name:   /home/sqreb/ORF_culster/blastdb/progbbct1.fasta
New DB title:  bct_protein data in genbank
Sequence type: Protein
Keep MBits: T
Maximum file size: 1000000000B
Adding sequences from FASTA; added 50272 sequences in 1.98013 seconds.
makeblastdb -in progbbct2.fasta -input_type fasta -dbtype prot -parse_seqids -title 'bct_protein data in genbank' 


Building a new DB, current time: 07/21/2016 16:06:30
New DB name:   /home/sqreb/ORF_culster/blastdb/progbbct2.fasta
New DB title:  bct_protein data in genbank
Sequence type: Protein
Keep MBits: T
Maximum file size: 1000000000B
Adding sequences from FASTA; added 70668 sequences in 2.765 seconds.
sqreb@sqreb-Vostro-1450:~/ORF_culster/blastdb$ cat -b progbbct1.fasta progbbct2.fasta >> progbbct_12.fasta
sqreb@sqreb-Vostro-1450:~/ORF_culster/blastdb$ makeblastdb -in progbbct_12.fasta -input_type fasta -dbtype prot -parse_seqids -title 'bct_protein data in genbank'


Building a new DB, current time: 07/21/2016 16:08:07
New DB name:   /home/sqreb/ORF_culster/blastdb/progbbct_12.fasta
New DB title:  bct_protein data in genbank
Sequence type: Protein
Keep MBits: T
Maximum file size: 1000000000B
BLAST options error: progbbct_12.fasta does not match input format type, default input type is FASTA

This is my blast file:

>BAA21794.1|AB000100.1 intrinsic membrane protein|121..912
MVRTPVPLYLRWAVSILSVLAFLAIWQIAAASGFLGKTFPGSLRTLQDLFGWLSDPFFDN
GPNDLGIGWNLLISLRRVAIGYLLATVVAIPLGIAIGMSALASSIFSPFVQLLKPVSPLA
WLPIGLFLFRDSELTGVFVILISSLWPTLINTAFGVANVNPDFLKVSQSLGASRWRTILK
VILPAALPSIIAGMRISMGIAWLVIVAAEMLLGTGIGYFIWNEWNNLSLPNIFSAIIIIG
IVGILLDQGFRFLENQFSYAGNR
>BAA21795.1|AB000100.1 malK-like protein|916..1785
MISEAVPAKEETGQAQLLIEQVGKVFTVNSPSLLDRLRQRSPKRYVALEDVNLTIASNTF
VSIIGPSGCGKSTLLNLIAGLDLPTSGQILLDGQRIRSPGPDRGIVFQNYALMPWMTALE
NVIFAVETARPNLSKSQAREVAREHLELVGLTKAADRYPGQISGGMKQRVAIARALSIRP
KLLLMDEPFGALDALTRGYLQEEVLRIWEANKLSVVLITHSIDEALLLSDRIVVMSRGPR
ATIREVIDLPAVRPRQRSVIEEDERFVKIKLRLEEHLFNETRAVEEASV
...
>BAL47787.1|AB648215.1 isocitrate dehydrogenase|<1..>518
DAAVEKAYKGERKISWMEIYTGEKSTQVYGQDVWLPAETLDLIREYRVAIKGPLTTPVGG
GIRSLNVALRQELDLYICLRPVRYYQGTPSPVKHPELTDMVIFRENSEDIYAGIEWKADS
ADAEKVINFLREEMGVKKIRFPEHCGIGIKPCSEEGTKRLVRAAIEYAIAND
>BAL47788.1|AB648216.1 isocitrate dehydrogenase|<1..>518
DAAVEKAYKGERKISWMEIYTGEKSTQVYGQDVWLPAETLDLIREYRVAIKGPLTTPVGG
GIRSLNVALRQELDLYICLRPVRYYQGTPSPVKHPELTDMVIFRENSEDIYAGIEWKADS
ADAEKVIKFLREEMGVKKIRFPEHCGIGIKPCSEEGTKRLVRAAIEYAIAND
(END)
makeblastdb blast options error input format type
• 8,889 views • link
updated by Sej Modha Sej Modha • written by 2013302630028 • 2013302630028

1 answer

I have tested your command with the sample file provided on BLAST+ version 2.4.0+ and it works.

• 1 views • link
written by Sej Modha Sej Modha 
I combined the genbank files together and transfer into fasta format, it works. But tell me this one.What's wrong with my  BLAST+？ thanks.

sqreb@sqreb-Vostro-1450:~/ORF_culster/blastdb$ makeblastdb -in bct_12.fasta -input_type fasta -dbtype prot -parse_seqids -title 'bct_protein data in genbank'


Building a new DB, current time: 07/21/2016 18:03:18
New DB name:   /home/sqreb/ORF_culster/blastdb/bct_12.fasta
New DB title:  bct_protein data in genbank
Sequence type: Protein
Keep MBits: T
Maximum file size: 1000000000B
FASTA-Reader: Ignoring invalid residues at position(s): On line 2: 45-46
FASTA-Reader: Ignoring invalid residues at position(s): On line 3: 45-46
FASTA-Reader: Ignoring invalid residues at position(s): On line 4: 45-46
...
FASTA-Reader: Ignoring invalid residues at position(s): On line 834524: 50-56
FASTA-Reader: Ignoring invalid residues at position(s): On line 834527: 45-51
Adding sequences from FASTA; added 120940 sequences in 20.5835 seconds.
• 1 views • link
written by 2013302630028 • 2013302630028

There is some bug in my parser and I fix it. Thank you!

• 1 views • link
written by 2013302630028 • 2013302630028

Log in to answer this question.

More posts like this