This is a test version of Biostars. For the public version, visit https://www.biostars.org.
Translating A Mitochondrial Cdna

Here is the cDNA for the UCSC knowngene uc011mfh.1 , a protein said to be on the chrM:5,855-7,427. http://genome.ucsc.edu/cgi-bin/hgTracks?org=Human&db=hg19&position=uc011mfh.1

ATGATCTGCTGCAGTGCTCTGAGCCCTAGGATTCATCTTTCTTTTCACCG
TAGGTGGCCTGACTGGCATTGTATTAGCAAACTCATCACTAGACATCGTA
CTACACGACACGTACTACGTTGTAGCTCACTTCCACTATGTCCTATCAAT
AGGAGCTGTATTTGCCATCATAGGAGGCTTCATTCACTGATTTCCCCTAT
TCTCAGGCTACACCCTAGACCAAACCTACGCCAAAATCCATTTCACTATC
ATATTCATCGGCGTAAATCTAACTTTCTTCCCACAACACTTTCTCGGCCT
ATCCGGAATGCCCCGACGTTACTCGGACTACCCCGATGCATACACCACAT
GAAACATCCTATCATCTGTAGGCTCATTCATTTCTCTAACAGCAGTAATA
TTAATAATTTTCATGATTTGAGAAGCCTTCGCTTCGAAGCGAAAAGTCCT
AATAGTAGAAGAACCCTCCATAAACCTGGAGTGACTATATGGATGCCCCC
CACCCTACCACACATTCGAAGAACC

and here is the protein for this gene ( http://genome.ucsc.edu/cgi-bin/hgGene?hgg_do_getProteinSeq=1&hgg_gene=uc011mfh.1 )

>uc011mfh.1 (BC018860) length=175
MICCSALSPRIHLSFHRRWPDWHCISKLITRHRTTRHVLRCSSLPLCPINRSCICHHRRL
HSLISPILRLHPRPNLRQNPFHYHIHRRKSNFLPTTLSRPIRNAPTLLGLPRCIHHMKHP
IICRLIHFSNSSNINNFHDLRSLRFEAKSPNSRRTLHKPGVTIWMPPTLPHIRRT

translating the cDNA using the standard genetic code at http://www.ebi.ac.uk/Tools/emboss/transeq/ returns the same peptide:

>EMBOSS_001_1
MICCSALSPRIHLSFHRRWPDWHCISKLITRHRTTRHVLRCSSLPLCPINRSCICHHRRL
HSLISPILRLHPRPNLRQNPFHYHIHRRKSNFLPTTLSRPIRNAPTLLGLPRCIHHMKHP
IICRLIHFSNSSNINNFHDLRSLRFEAKSPNSRRTLHKPGVTIWMPPTLPHIRRT

but if the mitochondrial genetic code is used, the protein contains many stops:

>EMBOSS_001_1
MICCSALSP*IHLSFHR*WPDWHCISKLIT*HRTTRHVLRCSSLPLCPIN*SCICHH**L
HSLISPIL*LHP*PNLRQNPFHYHIHRRKSNFLPTTLSRPIRNAPTLLGLPRCMHHMKHP
IIC*LIHFSNSSNINNFHDL*SLRFEAKSPNS**TLHKPGVTMWMPPTLPHIR*T

is it me or is it a bug ?

Pierre

translation mitochondria cdna ucsc
• 3,466 views • link
updated by Neilfws Neilfws • written by Pierre Lindenbaum Pierre Lindenbaum

All the stops are 'R's which is arginine. Arginine is a stop codon in mitochondria.

• 0 views • link
written by Kieren Lythgow • Kieren Lythgow

Indulging a bit of curiosity, I took the DNA fragment and searched Ensembl with it to see what they said. There this turns out to be the tail end of MT-CO1-201, which covers MT: 5,904-7,445. The mitochondrial gene models in Ensembl come from the source entries GenBank J01415 and RefSeq NC_012920. So it appears that, in the case at least, re-annotation was not a good idea.

• 0 views • link
written by Hamish Hamish

2 answers

I get more or less the same result and so can only conclude that UCSC have used the standard, not mitochondrial, genetic code to translate in this case.

This is not unprecedented - see this recent discussion on the UCSC mailing list. Their response is that it's on their to-do list.

• 1 views • link
written by Neilfws Neilfws

Thank you Neil, for pointing this thread on the UCSC mailing list.

• 0 views • link
written by Pierre Lindenbaum Pierre Lindenbaum

Is it possible that the cDNA sequence was imputed from the amino acid sequence, using the standard translation table?

• 1 views • link
written by dfornika dfornika

no, my cDNA was constructed from the genomic DNA and the structure of the gene.

• 0 views • link
written by Pierre Lindenbaum Pierre Lindenbaum

Log in to answer this question.

More posts like this
  • Old Version Of Bwa And Soft Clipping
    written by Pierre Lindenbaum Pierre Lindenbaum
    <p>can you confirm this:</p> <p>one of my <a href='http://samtools.sourceforge.net/SAM1.pdf'>bam</a> was aligned with an 'old' version of <a href='http://bio-bwa.sourceforge.net/'>BWA</a>:</p> <pre><code>@PG ID:bwa PN:bwa VN:0.6.2-r126 </code></pre> <p>some reads …
  • Exome Variant Server: What Are Those Gaps ?
    written by Pierre Lindenbaum Pierre Lindenbaum
    <p>Here is a screenshot of the Exome Variant Server data: </p> <p><img src='http://i.imgur.com/6PfpkHJ.jpg' alt='http://i.imgur.com/6PfpkHJ.jpg' /></p> <p>Does anyone know what those gaps are ? Some deletions …
  • Galaxy "Stitch Maf Blocks" Produced Null Bases
    written by lam • lam
    <p>problem: "stitch MAF blocks" produced NULL bases </p> <p>steps: From <a href='http://genome.ucsc.edu/cgi-bin/das/hg19/dna?segment=chrY:23310464,23331995'>http://genome.ucsc.edu/cgi-bin/das/hg19/dna?segment=chrY:23310464,23331995</a></p> <p>we got the following bases:</p> <pre><code>agtttacccaactcacaggtatttgaggatacaaacccatgactgggcttggctttaaaaattcctatctgaaatttctagt.......... </code></pre> <p>We want to do multiple-species alignment …
  • Hyperlink To Specific Ucsc Genome Browser Page
    written by alex alex
    <p>I am trying to create a hyperlink. I have an example of </p> <pre><code>Chromosome chr15 Genomic Coords 70455115 -7042353 </code></pre> <p>So I put that into …
  • Export Fasta File With Multiple Non-Coding Rna Sequences
    written by hicsuntdrac0nis • hicsuntdrac0nis
    <p>I have recently been using UCSC's Table Browser (<a href='http://genome.ucsc.edu/cgi-bin/hgTables'>http://genome.ucsc.edu/cgi-bin/hgTables</a>) where I can copy a list of genes and it returns one single FASTA file …
  • High-Quality Zebrafish Dbsnp Database
    written by michealsmith michealsmith
    <p>How to download zebrafish dbSNP database, in vcf format at the best?</p> <p>I've checked UCSC: <a href="http://genome.ucsc.edu/cgi-bin/hgTables?org=Zebrafish&amp;db=danRer7&amp;hgsid=255390817&amp;hgta_doMainPage=1)">http://genome.ucsc.edu/cgi-bin/hgTables?org=Zebrafish&amp;db=danRer7&amp;hgsid=255390817&amp;hgta_doMainPage=1)</a> It's werid there's no dbSNP column for fish; …
  • Ucsc Snp Genomic Positions (Duplicates And Wrong Positions)
    written by Panagiotis Alexiou • Panagiotis Alexiou
    <p>I have a serious problem with UCSC SNP locations. Briefly:</p> <p>I have downloaded from Tables =&gt; hg18, the table SNP130 as a bed file. This …
  • Accessing Reactome.Org Using Soap And Curl?
    written by Pierre Lindenbaum Pierre Lindenbaum
    <p>Hi all,</p> <p>I'm trying to send a SOAP query to <a href="http://www.reactome.org/">Reactome</a> using curl.</p> <p>I want to call the remote method <strong>queryPathwaysForReferenceIdentifiers</strong> defined in <a …
  • Mass Spectrometry : I'M Looking For A Web Service
    written by Pierre Lindenbaum Pierre Lindenbaum
    <p>Hi all,</p> <p>First and foremost, I must say that I am a complete ignorant regarding mass spectrometry.</p> <p>A colleague of mine has received some masspec …
  • Biodas : Can I Retrieve Some Metadata About A Segment ?
    written by Pierre Lindenbaum Pierre Lindenbaum
    <p>Hi all,</p> <p>I wonder if there is a <strong><a href='http://www.biodas.org/wiki/Main_Page'>biodas</a></strong> way to retrieve some metadata from a <strong>feature?segment=</strong> query</p> <p>For example: in <a href='http://genome.ucsc.edu/cgi-bin/das/hg18/features?segment=22:14504273,14622020;type=knownGene'>http://genome.ucsc.edu/cgi-bin/das/hg18/features?segment=22:14504273,14622020;type=knownGene</a></p> <pre><code>&lt;?xml …