This is a test version of Biostars. For the public version, visit https://www.biostars.org.
How Can I Find Utr Regions Of This Gene?

Hi everyone, I have this gene (Accession: XM_968180.1) from NCBI and I need its 5' UTR and 3' UTR regions. Could any of you help me figure out the way to retrieve those regions from NCBI? Thank you for your help.

utr gene
• 4,533 views • link
written by biostar • biostar

I would normally suggest BioMart, but it returns no 5'/3' data for that accession. Note that it is a predicted mRNA and may not be characterised.

• 42 views • link
written by Neilfws Neilfws

Maybe, before doing a lot of guess work, going to the lab will yield results (see RACE PCR).

• 201 views • link
written by Michael Dondrup Michael Dondrup

0 answers

No answers yet.

Log in to answer this question.

More posts like this
  • Extracting nucleotide sequences associated with specific GenPept annotated regions
    written by alopex • alopex
    I'm looking for a way to extract the nucleotide sequences of NCBI GenBank records corresponding to specific annotated regions in the associated NCBI GenPept records …
  • Why do NCBI rRNA sequences have thymine?
    written by lance.leung • lance.leung
    I am slightly confused here, why are there thymine bases in the NCBI rRNA base sequence? This link shows an example of it. https://www.ncbi.nlm.nih.gov/nucleotide/NR_026332.1?report=genbank&log$=nuclalign&blast_rank=1&RID=E92WF98W014 Would …
  • Understanding NCBI identifiers
    written by tlorin tlorin
    This is kind of a general question regarding NCBI accesion numbers. Suppose I have this sequence >myseq MGQ-----NSPNLLR------LSQ --TLVGSSLLSSPSSPTTLKVKMPHAFPFLTPDQ-KKELSDIAHKIVAKGKGILAADES- --TGSVAKRFQSINTENTEENRRLYRQLLFTA-DERAGPCIGGVIFFHETLYQKTDAGKT FPEHVKSRGWVVGIKVDKGVVPLAGTN-GETTTQ---GLDGL--------YERCAQYKKD GCDFAKWRCVLKITSTTPSRLAIMENCNVLARYASICQM--HGIVPIVEPEILPDGDHDL KRTQYVTEKV-LAAMYKALSDHHVYLEGTLLKPNMVTAGHSCSHKYTHQDIAMATITALR RTVPPAVPG--ITFLSGGQSEEEASINLNVMNQCPLHRPWAITFSYGRALQASALKAWGG KPGNGKAAQEEFIKRAL------ANSLACQGKYVSSGN-S-A-AAGDSLFVANHAY …
  • Autosomal SNPs tagging sex chromosomes?
    written by Purpleone Purpleone
    Hi, I've got some human GWAS data and looking at rs7329280 (chr13), which seems to be highly associated with the sex. This doesn't make much …
  • Ncbi Eutilities Get Data By Accession Number , Perl
    written by Maria • Maria
    <p>Hello, </p> <p>I want to retrieve genbank files for all Chordata. I have already the accession numbers for all the Chordata. I read about getting …
  • How To Retrieve All Sequences, From Ncbi, That Belong To A Specific Txid And Its Sub Txids?
    written by Nicojo • Nicojo
    <p>I am trying to retrieve all the nucleotide sequences from Genbank that belong to a txid and its "children" txids, e.g. <a href="http://www.ncbi.nlm.nih.gov/Taxonomy/Browser/wwwtax.cgi?mode=Tree&amp;id=5833&amp;lvl=3&amp;lin=f&amp;keep=1&amp;srchmode=1&amp;unlock">txid5833</a>. As you …
  • How To Properly Limit Result From Eutils To Get Tinyseq Xml Output
    written by user56 user56
    <p>I have a gene of interest. Eg., TPMP It is this one: <a href='http://www.ncbi.nlm.nih.gov/sites/entrez?db=gene&amp;cmd=Retrieve&amp;dopt=Graphics&amp;list_uids=7172'>http://www.ncbi.nlm.nih.gov/sites/entrez?db=gene&amp;cmd=Retrieve&amp;dopt=Graphics&amp;list_uids=7172</a></p> <p>In XML I can get the same info via this link: …
  • Retrieve Sequences Flanking Ends Of A List Of Genes
    written by Abaldwin • Abaldwin
    <p>I have a list of say ~100 genes and want to retrieve the 50 nucleotides that are just downstream of the ends of these genes. …
  • Protein Coding Sequence
    written by Gleb • Gleb
    <p>Hello!!</p> <p>I'm very uncomfortable, but could you help me. Let's see at this link <a href="http://www.ncbi.nlm.nih.gov/protein">http://www.ncbi.nlm.nih.gov/protein</a> In menu Search (bee) AND "Apis mellifera"[porgn:__txid7460]. And choose …
  • Is It Possible To Find For A Given Gene The Coding Sequences On Ensembl?
    written by Blunders • Blunders
    <p>This information has been found on NCBI, but attempting to find it on Ensembl.</p> <p>On NCBI, is was found by:</p> <ul> <li>Going to this <a …