This is a test version of Biostars. For the public version, visit https://www.biostars.org.
to extract fasta file from PDB and obtain the content of file only as protein sequence

is there any python code to extract fasta file from PDB for a given protein_id(eg:- 1mkp)

alignment sequence assembly

1 answer

import sys
from Bio import SeqIO

PDBFile = sys.argv[1]
with open(PDBFile, 'r') as pdb_file:
    for record in SeqIO.parse(pdb_file, 'pdb-atom'):
        print('>' + record.id)
        print(record.seq)

Save as pdb-seq.py. Download PDB coordinates for 1mkp and type:

python pdb-seq.py 1mkp.pdb

>1MKP:A
ASFPVEILPFLYLGCAKDSTNLDVLEEFGIKYILNVTPNLPNLFENAGEFKYKQIPISDHWSQNLSQFFPEAISFIDEARGKN
CGVLVHSLAGISRSVTVTVAYLMQKLNLSMNDAYDIVKMKKSNISPNFNFMGQLLDFERTL

code should be for python 3

for record in SeqIO.parse(pdb_file, 'pdb-atom'): ^ SyntaxError: unexpected EOF while parsing Plase resolve is problem also for me

code should be for python 3

This code works fine with Python 3.6 on my computer. Also, I think you may be under a wrong impression that I should be troubleshooting this even after providing full code for you.

Good day!

Thanks for the script.

It works, but I have a question. How can I know the sequence FASTA of a specific selection of the PDB file? For example, if I have a chain with 100 residues, but I want to know only the first 10 residues FASTA sequence, how can I do that?

Thank you so much.

Regards, Brandon U.

You can modify Mensur Dlakic 's code as follows. This will get you the first 10 AA.

import sys
from Bio import SeqIO

PDBFile = sys.argv[1]
with open(PDBFile, 'r') as pdb_file:
    for record in SeqIO.parse(pdb_file, 'pdb-atom'):
        print('>' + record.id)
        print(record.seq[:10])

Check the [:10] addition that is making this possible. You can use an appropriate interval e.g. [4:24] to get other sections of the sequence.

Log in to answer this question.