This is a test version of Biostars. For the public version, visit https://www.biostars.org.
Blast standalone output formatting

Hi,

I am running tblastn standalone in ubuntu. I wanted to sort the output format 0 (pairwise)using percentage identity. I am able to do this with output format 6 or 7, but not with 0.

Thanks

blast
• 4,094 views • link
updated by Ram Ram • written by sukesh1411 • sukesh1411

To get more help, please provide the command that you're running to sort it, and an example of the output (4-5 lines).

• 0 views • link
written by Matteo Schiavinato Matteo Schiavinato

Hi

The command used for tblastn

tblastn -query allpeptide.fa -subject BDCS01.1.fsa_nt -outfmt 0 > results.txt. In 6 or 7 format i can export the results into excel and sort it based on the percentage identity, but in these formats i cant visualize the pairwise alignment results.

output file of format 0(pair wise)

Query= peptides

Length=255

Subject= dbj|BDCS01000002.1| Momordica charantia DNA, contig: scaffold_1,

strain: OHB3-1, whole genome shotgun sequence

Length=6565189

Score = 31.2 bits (69),  Expect = 0.14, Method: Compositional matrix adjust. 
Identities = 21/65 (32%), Positives = 30/65 (46%), Gaps = 3/65 (5%)
Frame = +3

Query  106      LYGGSSLS-PWYMCARMLLETNPKFSPNEYCFTYERLGGNSLAKVDEVYDCNARNMMNNA  164
                L+GG  L   W +  R + E + K     +CF  +R       K + +Y C  RN  N+A
Sbjct  6112794  LFGGDILVYIWQIITRFMNEIHKKKKSLCFCFEVQRNHFLVATKENHIYIC--RNCFNHA  6112967

Query  165      EPALS  169
                 P LS
Sbjct  6112968  IPPLS  6112982


Score = 26.9 bits (58),  Expect = 2.8, Method: Compositional matrix adjust.
Identities = 11/19 (58%), Positives = 13/19 (68%), Gaps = 0/19 (0%)
Frame = -3

Query  227      STCTEPSLSGSYLPHCGWH  245
                S+C E SLS S+   CGWH
Sbjct  6340289  SSCDENSLSNSFEHGCGWH  6340233

Query= peptides

Length=255

 Subject= dbj|BDCS01000005.1| Momordica charantia DNA, contig: scaffold_4,

strain: OHB3-1, whole genome shotgun sequence

Length=5144829


 Score = 27.7 bits (60),  Expect = 1.6, Method: Compositional matrix adjust.
Identities = 11/26 (42%), Positives = 16/26 (62%), Gaps = 0/26 (0%)
 Frame = +3

Query  200      NLPMDMTVWADPYCVTMDMPKMSKYG  225
                NLP D  V  DP+CV++D  +  K+ 
Sbjct  1511976  NLPADGAVGVDPWCVSVDTAQKWKHA  1512053

Thanks

• 0 views • link
written by sukesh1411 • sukesh1411

Please add the "code" tag to your output copypaste, it's impossible to understand like this. It's the 5th button from the left of your editor.

• 0 views • link
written by Matteo Schiavinato Matteo Schiavinato

As @genomax2 said here, it's impossible to sort such file because you don't have each line structured in the same way as the previous one (this is how sorting goes). To sort such type of file perhaps some Bioperl or Biopython modules exist, but it's definitely impossible to do it through command line.

• 0 views • link
written by Matteo Schiavinato Matteo Schiavinato

How would one be able to sort pair-wise text alignment results (format 0)? Other formats are sortable since they are pure numeric. If you need to filter your results above a certain alignment % (or something along those lines) then use an appropriate combination of blast paramters along with your -outfmt 0 directive.

• 0 views • link
written by GenoMax GenoMax

I suggest rerun the blast with outfmt 11, and convert it to any other outfmt (6 or 7) with blast_formatter.

• 0 views • link
written by shenwei356 shenwei356

1 answer

Your best bet is probably SearchIO from (Bio)python/perl.

http://biopython.org/wiki/SearchIO

It has parsers that are capable of reading in BLAST results. I assume what you're calling pairwise format, is what they call 'plain-text', in which case that format is supported by the parser. Alternatively, XML might be an option.

Once you've got all the records as objects, you can implement a sort/filter in python etc.

• 0 views • link
written by Joe Joe

Log in to answer this question.

More posts like this