Are the CASP11 Disorder Targets Available?

Looking at the CASP data archive here it looks like CASP9 and CASP10 have DR_targets under the targets directory, but CASP11 doesn't have a DR_targets file. Are CASP11 disorder targets available?

casp disorder data

• 1,348 views • link

updated 9.5 years ago by Biostar

• written 9.7 years ago by asdfxzsdf2 •

Please check the message board. http://www.predictioncenter.org/news.cgi#186

• 0 views • link

written 9.5 years ago by fishgolden

0 answers

No answers yet.

More posts like this

Understanding NCBI vs ENA data
written 1.1 years ago by wes •

I want to download PacBio RSII data with [accession number SRR6037732][1] for further analysis. In NCBI, there are both SRA archive files and original format …
jannovar download problem
written 3.0 years ago by curious

I am trying to convert some HGVS to chrom:pos:ref:alt format. I was thinking to use `jannovar`. As per the [documentation][1] I run: `jannovar download -d …
GDCdownload properties, path problem
written 4.3 years ago by Emre •

After I downloaded TCGA-UVM data, I needed also TCGA LUAD and LUSC datas to be downloaded. But when I used the same code all of …
DiffBind Error in if (file.info(peaks)$size > 0) { : missing value where TRUE/FALSE needed
written 5.1 years ago by alexmondaini •

Hi, I am trying to read a DBA object from a Samplesheet but DiffBind throws me an error despite having the file paths correctly set. …
Protein Secondary Structure Prediction
written 7.6 years ago by leila.khalatbari •

Hi everyone. Here are my questions. I have come up with a machine learning-based method for prediction of protein secondary structure. I evaluated my method …
tools to display gene number in go by level
written 9.2 years ago by l0o0

Hi, I am looking for some online tools to plot gene number in go term by level. The plot looks like below ![enter image description …
tools to display gene number in go by level
written 9.2 years ago by l0o0

Hi, I am looking for some online tools to plot gene number in go term by level. The plot looks like below ![enter image description …
miRNA Target database?
written 9.5 years ago by Buffo

Hi Everybody, Somebody knows which is the most complete and updated database for looking miRNA gene-targets (validated targets)? I have tried miRWalk but some results …
PhyML phylogeenetic tree figure generation
written 11.5 years ago by kozhaki.seq

I run PhyML software and generated 3 output files as expected. But am in confusion how to generate phylogenetic tree figure from `myseq.phy_phyml_tree.txt` file. Looking …
Bioinformatics Q: How to align and compare two elements (sequence) in a list using python
written 12.1 years ago by Jason Lin •

here is my question: I've got a file which looks like this: ``` 103L Sequence: MNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNSLDAAKSELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYKNL Disorder: ----------------------------------XXXXXX-----------------------------------------------------------------------------------------------------------------------------XX ``` It contains name, which in this …