error when converting hmmer table to off table
Hello, I performed an alignment using hmmer hmmsearch tool using metagenomic contigs as a query and a hydrocarbon database (hydrocarbon.hmm file).
I n first instance I first retrieved all ORFs from the contigs and translated them with esl-translate program as following:
esl-translate -c 11 input_contigs.fa > translated_orfs.fa
After getting the translated ORFs under the translated_orfs.fa file, I run the alignment with hmmsearch
hmmsearch --domtblout dom_results.txt --cpu 10 hydrocarbon.hmm translated_orfs.fa > logfile.
Once I get the dom_results.txt file I proceed to use the hmmer2gff program as the following:
hmmer2gff -d -o gffs/sample1.gff tanslated_orfs.fa $i dom_Results.txt
But I'm getting the following error:
Traceback (most recent call last): File "/Users/valentin-ignacio/opt/miniconda3/envs/mgkit/bin/hmmer2gff", line 11, in <module>
sys.exit(main()) File "/Users/valentin-ignacio/opt/miniconda3/envs/mgkit/lib/python3.7/site-packages/mgkit/workflow/hmmer2gff.py", line 212, in main
options File "/Users/valentin-ignacio/opt/miniconda3/envs/mgkit/lib/python3.7/site-packages/mgkit/workflow/hmmer2gff.py", line 153, in parse_domain_table_contigs
aa_seqs = get_aa_data(options.aa_file) File "/Users/valentin-ignacio/opt/miniconda3/envs/mgkit/lib/python3.7/site-packages/mgkit/workflow/hmmer2gff.py", line 143, in get_aa_data
for name, seq in fasta.load_fasta(f_handle) File "/Users/valentin-ignacio/opt/miniconda3/envs/mgkit/lib/python3.7/site-packages/mgkit/workflow/hmmer2gff.py", line 142, in <genexpr>
(name.split(' ')[0], seq) File "/Users/valentin-ignacio/opt/miniconda3/envs/mgkit/lib/python3.7/site-packages/mgkit/io/fasta.py", line 41, in load_fasta
line = line.decode('ascii') AttributeError: 'str' object has no attribute 'decode'
What can be happening here ?
This is the header of the aminoacidic fasta file:
>orf4 source=k141_332722 coords=96..221 length=42 frame=3 desc=flag=0 multi=8.4159 len=1747
PPQAIEQDFKYGIKAASLTTPSPTSEFIFNLFKLSQLQIKHS
Thanks for your time :)
Valentín.
• 1,075 views
•
link
1 answer
Hmmr2gff code needs python2 apparently and you use python3
• 0 views
•
link
Log in to answer this question.