Dear, all,
The de novo transcriptome gave me the following amino acid sequences. Many of the amino acid sequences start with methionine, but some of them do not start with methionine like this.
What is this protein?
>At_DN540_c0_g1_i10.p1 AEDLRETAGEYADSAKEKAENLKNRAKEHLPDSDTLSKTKESLKKKASDGKEYVQEKAEDLRETAGEYADSAKEKAENLKNRAKEHLPDSDTLSKTKESLKKKASDGKEYVQEKAEDLRETAGEYADSAKEKAENLKNRAKEQAENLKDNVKDKYDEYTDSAKEYANDAKDKVKSKTEEYTGSAKKTANDVKDKVKSKANDLKEGAQGMSESVSDSAREGFHHVEDKAEDIKEAGEQKKEEIDAKAEEAKSTIGGKIKSAADTVVGGVKSAAESVGSTVSGVFSSASDKADQAKEDVKEKAEEKREEIKESVRRKRETVGEKIDSNIEDAKSKASDAKAAAGEKIDEAKEKLNRFRRHTSAEEAGEKAGSTIDRAREKASEAGQAVGDKAKELKDDVTNRMKRAENDTVSGGGSKIGEGLAEIGGAAKTGAANAGATVVGGVIFAGEKVGEGAKAAKDKTVETAQAVGDKASEAAEAARQKADDAKNSFGKTVSFNTRSDTSIQNLGNL*
Thank you for reading.
Thank you very much for your help. I did a BLAST and found many hits in the front section of this protein sequence, as shown in the figure. It seems likely that the protein sequence is not complete.