This is a test version of Biostars. For the public version, visit https://www.biostars.org.
Modify FASTA headers

Hello! I have a FASTA file and I need a script that read in the file, changes all the headers to e new format and writes out all the sequences in a new output file. The modified headers should contain, for each sequence, the species name (with "_" rather than "space"), a space character, and the identifier in square brackets with "ALKBH1:" in front of it. Overall the headers should look like this

 > Homo_sapiens [ALKBH1:NP_001192039]

If any of you can generate a script for me with some line descriptions I would really appreciate it. I am a beginner in this field and I need some help. Thank you all in advance!

fasta python script headers
• 3,564 views • link
updated by Pierre Lindenbaum Pierre Lindenbaum • written by mpbiology.dna • mpbiology.dna

Each sequence in the input file looks like this:

>gi|122937263|ref|NP_001073901.1|/1-505 alkB1 DNA repair protein ALKBH1 [Homo sapiens]
MKRTPTAEEREREAKKLRLLEELEDTWLPYLTPKDDEFYQQWQLKYPKLILREASSVSEELHKEVQEAFLTL
HKHGCLFRDLVRIQGKDLLTPVSRILIGNPGCTYKYLNTRLFTVPWPVKGSNIKHTEAEIAAACETFLKLND
YLQIETIQALEELAAKEKANEDAVPLCMSADFPRVGMGSSYNGQDEVDIKSRAAYNVTLLNFMDPQKMPYLK
EEPYFGMGKMAVSWHHDENLVDRSAVAVYSYSCEGPEEESEDDSHLEGRDPDIWHVGFKISWDIETPGLAIP
LHQGDCYFMLDDLNATHQHCVLAGSQPRFSSTHRVAECSTGTLDYILQRCQLALQNVCDDVDNDDVSLKSFE
PAVLKQGEEIHNEVEFEWLRQFWFQGNRYRKCTDWWCQPMAQLEALWKKMEGVTNAVLHEVKREGLPVEQRN
EILTAILASLTARQNLRREWHARCQSRIARTLPADQKPECRPYWEKDDASMPLPFDLTDIVSELRGQLLEAK
P
• 0 views • link
updated by Pierre Lindenbaum Pierre Lindenbaum • written by mpbiology.dna • mpbiology.dna

Few assumptions: species is Hsa in all the sequences and protein id is alway 6 letters (for eg.ALKBH1). Should work with multifasta file. Code:

$ sed  '/^>/ s/.*\(NP.*\)|.*protein\s\(.\{6\}\)\s\[\(.\{4\}\)\s\(.\{7\}\).*/>\3_\4 \[\2: \1\]/g' test.fa

output:

>Homo_sapiens [ALKBH1: NP_001073901.1]

MKRTPTAEEREREAKKLRLLEELEDTWLPYLTPKDDEFYQQWQLKYPKLILREASSVSEELHKEVQEAFLTL

input:

$ cat test.fa 
>gi|122937263|ref|NP_001073901.1|/1-505 alkB1 DNA repair protein ALKBH1 [Homo sapiens]
MKRTPTAEEREREAKKLRLLEELEDTWLPYLTPKDDEFYQQWQLKYPKLILREASSVSEELHKEVQEAFLTL
• 0 views • link
written by cpad0112 cpad0112

You could (you should, in fact) start by trying something and ask for help after getting stuck. Then you describe what you tried (show the code), and show some relevant input / output. This question has been asked many times here and elsewhere, you can get started by reading the threads:

Question: Renaming Entries In A Fasta File

Question: How To Rename FASTA Headers

Question: Editing header of a fasta file

how to rename fasta file headers using sed

Modifying FASTA headers with Unix command line tools

Any script to parse fasta headers?

• 0 views • link
written by h.mon h.mon

0 answers

No answers yet.

Log in to answer this question.

More posts like this
  • End of molecules
    written by Pythonnoob • Pythonnoob
    Hello, For a project we got this question: A FASTA file contains a number of protein sequences. Write a Python script that, given the name …
  • Rename fasta headers using a variable already present in the header?
    written by FreshBio • FreshBio
    Hello Community! I know several similar questions have been asked but they all seem to want to rename their fasta headers entirely using a new …
  • Calculate CG content in a fastq file
    written by luzglongoria • luzglongoria
    Hi there, I would like to know the CG content of some fastq file. I have this script: This gives character count for all characters …
  • taxa names in phylogenetic tree
    written by erick_rc93 • erick_rc93
    I have a phylogenetic tree in newick format, and I would like to remove some fragments of the name of the taxa, 1_[genus_specie_1]_characters:0.2654682758,(((((((((((((((2_[genus_specie_2]_characters:0.0379334280,54_[genus_specie_2]_characters:0.0605802067)/1/100:0.0121248674,(3_[genus_specie_3]_characters:0.0206432295,4_[genus_specie_4]_characters:0.0141250479)/1/100:0.0647820408)/1/100:0.0235327264,30_[genus_specie_5]_characters I would …
  • Manipulating Text in Linux
    written by felipe_o_torquato • felipe_o_torquato
    Dear all, I am a beginner in Linux, hence I still have some small issues. For instance, I have a fasta file that looks like …
  • Fetching corresponding sequences from a fasta file using coordinates
    written by sharadlko1 • sharadlko1
    Hi everyone, I am new to python/biopython therefore I need this help. I want to use python/biopython to fetch the corresponding sequences from a fasta …
  • ncRNA analysis RNA Seq
    written by clueless • clueless
    I am new in the RNA Seq/R-script world and need help with some data I got from the RNA seq analysis. I would like to …
  • Runtime Needleman-Wunsch & Gotoh
    written by sarah-spie • sarah-spie
    I have a question regarding the runtime & memory space with 1. Needleman-Wunsch: A sequence with 1000 characters needs 1 second & 32 MB - …
  • Search through thousands of fasta sequences via the description field of the header using bioperl
    written by cjy8709 • cjy8709
    Hi everyone I have a fasta file where the header typically looks like this: >FBpp0071678 type=protein;loc=2R:join(18050425..18051199,18052282..18052494,18056749..18058222,18058283..18059490,18059587..18059757,18059821..18059938,18060002..18060032); ID=FBpp0071678; name=a-PB; parent=FBgn0000008,FBtr0071764; dbxref=FlyBase_Annotation_IDs:CG6741-PB,FlyBase:FBpp0071678,GB_protein:AAF46809.2,REFSEQ:NP_524641,GB_protein:AAF46809; MD5=9eb6e9e4c12ec62fdeb31cca5b0683b6; length=1329; release=r5.57; species=Dmel; ________________________________________________________________________________________________________________________________________________________________________________________________________^----------------^ …
  • How To Remove The Identifier And Quality From A Fastq File
    written by tenisha.phipps • tenisha.phipps
    I have a fastq file and need to remove the identifier, quality, and white space. So far my script looks something like this: #!/usr/bin/perl -w …