unrealated protein search
DLKDKGEYVCDCGTDKTKANVTVEARLIKVEKPLYGVEVFVGETAHFEIELSEPDVHGQWKLKGQPLTASPDCEIIEDGKTPLSDVKVFEKDEAKFECEVSREPKTFRWLKHILILHNCQLGMTGEVSFQAANAKSAANLKVKELPLIFI
Search for its most unrelated protein
Select longest helix of your protein then construct a PWM for the site and its 5 amino acids’ flanking region.
• 656 views
•
link
written
by
proteinssbp •
0 answers
No answers yet.
Log in to answer this question.
More posts like this
-
Is the definition of the secondary_structure_fraction function wrong?
written by renjing679 •
-
Parameter setting in BEASTv2.6.7
written by wes •
-
evaluate amino acid diversity at each position of peptide library
written by toth.joe •
-
How do I go about comparing domains
written by jamie_cooper2341 •
-
Protein isoforms and paralog sequences
written by Maverick •
-
modeling of large proteins
written by gitanjali.tandon •
-
mutations' effect on secondary structure
written by lait
-
Searching all proteins for a short degenerate consensus sequence
written by buchnerd
-
JMOL + Uniprot + Secondary Structure: Visualisation mismatch?
written by henry slade
-
Finding an exactly conserved amino acid sequence in a particular protein.
written by siddharth.avadhanam •
Hello proteinssbp!
We believe that this post does not fit the main topic of this site.
Looks like homework, but makes no sense to me at all. You should at least copy the question correctly or ask your supervisor to make better questions.
For this reason we have closed your question. This allows us to keep the site focused on the topics that the community can help with.
If you disagree please tell us why in a reply below, we'll be happy to talk about it.
Cheers!