This is a test version of Biostars. For the public version, visit https://www.biostars.org.
unrealated protein search

DLKDKGEYVCDCGTDKTKANVTVEARLIKVEKPLYGVEVFVGETAHFEIELSEPDVHGQWKLKGQPLTASPDCEIIEDGKTPLSDVKVFEKDEAKFECEVSREPKTFRWLKHILILHNCQLGMTGEVSFQAANAKSAANLKVKELPLIFI

Search for its most unrelated protein

Select longest helix of your protein then construct a PWM for the site and its 5 amino acids’ flanking region.

sequence

Hello proteinssbp!

We believe that this post does not fit the main topic of this site.

Looks like homework, but makes no sense to me at all. You should at least copy the question correctly or ask your supervisor to make better questions.

For this reason we have closed your question. This allows us to keep the site focused on the topics that the community can help with.

If you disagree please tell us why in a reply below, we'll be happy to talk about it.

Cheers!

0 answers

No answers yet.

Log in to answer this question.