This is a test version of Biostars. For the public version, visit https://www.biostars.org.
Converting Hmmer output to XML format

Hi,

I'm using phmmer search and I want to convert the output to XML, in order to have the percentage of identity parameter (which does not exist in any of the other formats, to the best of my knowledge). I've read about the package Hmmer.IO in Biopython, but didn't see an option to convert the output to XML. I've also read about Easel and esl-reformat command, but didn't find my desired option there either. Does anyone have a solution to this problem? My main goal is to extract the percentage of identity and coverage from Hmmer output, so if there's any other way to get these parameters besides the XML format, I'd love to hear about it.

Thank you!

hmmer biopython easel
• 3,051 views • link
written by adi4bc • adi4bc

and I want to convert the output to XML, in order to have the percentage of identity parameter

if the identity parameter is already in the output, why do you need to convert to XML ?

• 0 views • link
written by Pierre Lindenbaum Pierre Lindenbaum

I don't see the percentage of identity anywhere in my output file. Here's a part of it (I know it's a bit messy, but I didn't find a way to attach a file here)

# phmmer :: search a protein sequence against a protein database
# HMMER 3.1b2 (February 2015); http://hmmer.org/
# Copyright (C) 2015 Howard Hughes Medical Institute.
# Freely distributed under the GNU General Public License (GPLv3).
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query sequence file:             seq.fasta
# target sequence database:        /biodb/FASTA/uniprot/swissprot.fa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       gi|923093981|gb|ALB07772.1|  [L=470]
Description: neuraminidase [Influenza A virus (A/goose/Taiwan/TNO20/2015(H5N8))]
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence              Description
    ------- ------ -----    ------- ------ -----   ---- --  --------              -----------
          0 1043.3  15.2          0 1043.1  15.2    1.0  1  sp|Q07572|NRAM_I80A6   Neuraminidase OS=Influenza A virus (st
          0 1042.0  15.1          0 1041.9  15.1    1.0  1  sp|Q07570|NRAM_I88A1   Neuraminidase OS=Influenza A virus (st
          0 1039.1  15.3          0 1038.9  15.3    1.0  1  sp|Q07599|NRAM_I63A3   Neuraminidase OS=Influenza A virus (st
....
Domain annotation for each sequence (and alignments):
>> sp|Q07572|NRAM_I80A6  Neuraminidase OS=Influenza A virus (strain A/Duck/Hokkaido/8/1980 H3N8) GN=NA PE=3 SV=2
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ! 1043.1  15.2         0         0       1     470 []       1     470 []       1     470 [] 1.00

  Alignments for each domain:
  == domain 1  score: 1043.1 bits;  conditional E-value: 0
  gi|923093981|gb|ALB07772.1|   1 mnpnqkivtigsislglvvfnvllhavsiiltvlalgksenngicngtvvrehnetvriekvtqwyntsvveyvphwnegty 82 
                                  mnpnqki+tigsislglvvfnvllh vsii+tvl lg+  nngicn tvvre+netvriekvtqw+ntsvveyvp+wnegty
         sp|Q07572|NRAM_I80A6   1 MNPNQKIITIGSISLGLVVFNVLLHVVSIIVTVLVLGRGGNNGICNETVVREYNETVRIEKVTQWHNTSVVEYVPYWNEGTY 82 
                                  8********************************************************************************* PP
• 0 views • link
updated by Pierre Lindenbaum Pierre Lindenbaum • written by adi4bc • adi4bc

so , converting this to XML won't change anything isn't it ?

• 0 views • link
written by Pierre Lindenbaum Pierre Lindenbaum

Okay, so do you know how to get the identity percentage and coverage from Hmmer output, using python?

• 0 views • link
written by adi4bc • adi4bc

Biopython's Bio.SearchIO module currently only reads in various formats like HMMER or BLAST - it does not handle output.

• 0 views • link
written by Peter Peter

0 answers

No answers yet.

Log in to answer this question.

More posts like this