This is a test version of Biostars. For the public version, visit https://www.biostars.org.
How can i extract only Few sequences from my fasta file ?

Hi, Everyone. I have a fasta file with thousands of sequences with peg IDs. Can anyone please help me to extract only particular sequences based on there peg ID........ Thanks in advance !!

.fasta file looks...

>fig|6666666.167416.peg.1
MYVAGHEGIELQPLSAADDAEARRLADEYFSRIDPAGR
>fig|6666666.167416.peg.2
MTHNQCLDLLESAEDTLDFLKSSLTYLGSPQKTENKAR
>fig|6666666.167416.peg.3
MIAHASTPYSRKRGEPGPPHGPGLRRNEPHSGSTPFSL
>fig|6666666.167416.peg.4
MLLAAGRNRSARAAAREATGQDRCGGKRTGRKSGFPE
>fig|6666666.167416.peg.5
MDVRAPRAAPTGSDWRCRGRFSFFPRRSSFRSGARRL
>fig|6666666.167416.peg.6
MQIMVIEAMKEGADPEALLSSAQKVIDERTKELDKLD
>fig|6666666.167416.peg.7
MHELQQALANLNTVLRRLDRNPAQYLLGGENIEETKP
>fig|6666666.167416.peg.8
MLGHGRLQGSVRWRGAARKAVGGFLPSGLRPHHEISE

From this, for example, I just want to extract the sequences of >fig|6666666.167416.peg.2 to >fig|6666666.167416.peg.7 based on their ID number. excepting some python script....

rna-seq sequencing next-gen

You can edit with certain linux command if ur working on linux system.

Or else there are some perl scrpits available online which can help you out

Pls show us what have your tried or what approach would be good. And you are expecting Python script?

Wow, it's not like anyone asked this question ever before..

Hello k.kathirvel93!

Questions similar to yours can already be found at:

We have closed your question to allow us to keep similar content in the same thread.

If you disagree with this please tell us why in a reply below. We'll be happy to talk about it.

Cheers!

0 answers

No answers yet.

Log in to answer this question.