This is a test version of Biostars. For the public version, visit https://www.biostars.org.
Regarding fasta file format

Hi all,

I have a basic question, I recently got an excel file with two columns, one is gene id and another is protein sequence. I want to make a blast database from these sequences. After copy/pasting those in the Notepad (I know copy/pasting is a wrong task), they are like here:

>839263    MASGGKAKYIIGALIGSFGISYIFDKVISDNKIFGGTTPGTVSNK
>837071    MASLLDKAKDFVADKLTAIPKPEGSVTDVDLKDVNRDSVEYLAKV

Could you please help me out how I can change the excel file to a text file with the correct fasta format?

Thanks

fasta
• 2,605 views • link
updated by Ram Ram • written by seta seta

"Notpad": I like this better than the original name. "Not" useful for much.

• 0 views • link
written by Matt Shirley Matt Shirley

1 answer 

sed -e 's/ \+/\n/' input.txt > output.fa
• 0 views • link
written by Devon Ryan Devon Ryan

Thanks for your response. But the format was not changed, and the error of "BLAST options error: file.fa does not match input format type, default input type is FASTA" still appears when I try to make blast database.

• 0 views • link
written by seta seta

Presumably you have a tab between the columns rather than a space, so change the space in the command to \t.

• 0 views • link
written by Devon Ryan Devon Ryan

yes, it's tab, I try it. thanks

• 0 views • link
written by seta seta

Log in to answer this question.

More posts like this