Thanks for your response. But the format was not changed, and the error of "BLAST options error: file.fa does not match input format type, default input type is FASTA" still appears when I try to make blast database.
Regarding fasta file format
Hi all,
I have a basic question, I recently got an excel file with two columns, one is gene id and another is protein sequence. I want to make a blast database from these sequences. After copy/pasting those in the Notepad (I know copy/pasting is a wrong task), they are like here:
>839263 MASGGKAKYIIGALIGSFGISYIFDKVISDNKIFGGTTPGTVSNK
>837071 MASLLDKAKDFVADKLTAIPKPEGSVTDVDLKDVNRDSVEYLAKV
Could you please help me out how I can change the excel file to a text file with the correct fasta format?
Thanks
• 2,616 views
•
link
1 answer
Log in to answer this question.
"Notpad": I like this better than the original name. "Not" useful for much.