I quickly wrote a tool to retrieve the DNA sequence from a BLAST+XML output: https://github.com/lindenb/jvarkit/wiki/Biostar160470 (note that I didn't pay attention to the correct position for the junctions where there is a gap )

e.g.:

cat roxan.fa | ${bin.dir}/tblastn -db blastdb -outfmt 5 | java -jar biostar160470.jar -p ${bin.dir} -d blastdb| xmllint --format -

Output:

(...)
              <Hsp>
                <Hsp_num>5</Hsp_num>
                <Hsp_bit-score>31.9574</Hsp_bit-score>
                <Hsp_score>71</Hsp_score>
                <Hsp_evalue>0.000226217</Hsp_evalue>
                <Hsp_query-from>520</Hsp_query-from>
                <Hsp_query-to>575</Hsp_query-to>
                <Hsp_hit-from>1711</Hsp_hit-from>
                <Hsp_hit-to>1860</Hsp_hit-to>
                <Hsp_query-frame>0</Hsp_query-frame>
                <Hsp_hit-frame>1</Hsp_hit-frame>
                <Hsp_identity>16</Hsp_identity>
                <Hsp_positive>27</Hsp_positive>
                <Hsp_gaps>6</Hsp_gaps>
                <Hsp_align-len>56</Hsp_align-len>
                <Hsp_qseq>MGEFRLCDRLQKGKACPDGDKCRCAHGQEELNEWLDRREVLKQKLAKARKDMLLCP</Hsp_qseq>
                <Hsp_hseq>VGSYYLCKDMINKQDCKYGDNCTFAYHQEEIDVWTEERK------GTLNRDLLFDP</Hsp_hseq>
                <Hsp_midline>+G + LC  +   + C  GD C  A+ QEE++ W + R+          +D+L  P</Hsp_midline>
                <Hsp_hit-DNA>GTGGGCTCCTACTACCTGTGCAAAGACATGATTAACAAGCAGGACTGTAAGTACGGGGATAACTGCACCTTCGCCTACCATCAGGAGGAGATCGACGTGTGGACCGAGGAGCGGAAG------------------CTGCTCTTCGACCCG</Hsp_hit-DNA>
              </Hsp>
              <Hsp>
                <Hsp_num>6</Hsp_num>
                <Hsp_bit-score>22.3274</Hsp_bit-score>
                <Hsp_score>46</Hsp_score>
                <Hsp_evalue>0.215374</Hsp_evalue>
                <Hsp_query-from>22</Hsp_query-from>
                <Hsp_query-to>62</Hsp_query-to>
                <Hsp_hit-from>3316</Hsp_hit-from>
                <Hsp_hit-to>3435</Hsp_hit-to>
                <Hsp_query-frame>0</Hsp_query-frame>
                <Hsp_hit-frame>1</Hsp_hit-frame>
                <Hsp_identity>15</Hsp_identity>
                <Hsp_positive>19</Hsp_positive>
                <Hsp_gaps>1</Hsp_gaps>
                <Hsp_align-len>41</Hsp_align-len>
                <Hsp_qseq>HEAPWTNLTPSWRRPTHRTTVPLAVLRNQPPRQSPACPTLP</Hsp_qseq>
                <Hsp_hseq>HQAAPSPLRPCPSSPHHRPGVRTQAHVLQPP-EAPLKPGLP</Hsp_hseq>
                <Hsp_midline>H+A  + L P    P HR  V       QPP ++P  P LP</Hsp_midline>
                <Hsp_hit-DNA>CATCAGGCAGCCCCCAGCCCCCTGAGGCCCTGTCCATCTTCTCCCCACCACCGCCCCGGTGTGCGTACCCAGGCGCACGTGCTGCAGCCCCCG---GCCCCGCTGAAACCTGGGCTGCCC</Hsp_hit-DNA>
              </Hsp>

You could parse identifier, range and strand info into a file and then use blastdbcmd?

 -entry_batch <File_In>
   Input file for batch processing (Format: one entry per line, seq id
   followed by optional space-delimited specifier(s)
   [range|strand|mask_algo_id]

 -outfmt <String>
   Output format, where the available format specifiers are:
           %f means sequence in FASTA format
           %s means sequence data (without defline)
           %a means accession
           %g means gi
           %o means ordinal id (OID)
           %i means sequence id
           %t means sequence title
           %l means sequence length
           %h means sequence hash value
           %T means taxid
           %e means membership integer
           %L means common taxonomic name
           %S means scientific name
           %P means PIG
           %m means sequence masking data.
              Masking data will be displayed as a series of 'N-M' values
              separated by ';' or the word 'none' if none are available.
       If '%f' is specified, all other format specifiers are ignored.
       For every format except '%f', each line of output will correspond
       to a sequence.
   Default = `%f'