Rfold file form T-Coffee conversion to structure readable format
The file generated form R-coffee output an Rfold file which is having structure information. How to open these files? How to draw out structures from Rfold file?
alignment
software-error
• 1,646 views
•
link
updated
by
Ram
4.5K
• |
written
by
kaur.devbio
0
0 answers
No answers yet.
Log in to answer this question.
More posts like this
-
Is there a way to visualize RNA fold in R
written by Serij´s 0Hi, I am currently using the LncFinder-package in R to predict the secondary structure of RNA. I generated multiple dot-bracket-notations and I was wondering if …
-
How to convert 10x matrix.mtx.gz files to hdf5 format?
written by johnny rocketfingers 3I have a bunch of folders containing barcodes.tsv.gz, features.tsv.gz, and matrix.mtx.gz from the Cellranger Count output for a single-cell dataset that was sent to me …
-
Annotation of results from CD-HIT web server
written by pujaabhaskaranathan7079 0A lot of output files are generated as a result of cd-hit web server while checking for removal of redundant sequences. Which output file should …
-
miRNA predictions from large set of long non coding RNA
written by Bioinfonext 48I have de novo assembled transcript using Trinity. After annotation with nr database and Coding potential filtering, I have around 10,000 transcripts which can be …
-
CHIMERA: How do I open multiple PDB files in seperate windows (Mac OS X).
written by alexille5640 1I'm running Chimera on my mac. When I have a protein structure from a PDB file open and running, and I try to open a …
-
How can I use BALIBASE as a benchmark (on line)
written by sallyzaki70 1Earlier I asked a question of how i compare between(clustal/t-coffee/muscle) https://www.biostars.org/p/297397/ my work will be on line <br> 1-i used the data set >seq0 FQTWEEFSRAAEKLYLADPMKVRVVLKYRHVDGNLCIKVTDDLVCLVYRTDQAQDVKKIEKF …
-
Circos histogram from SNP.VCf file
written by Bioinfonext 48I have called SNP in transcriptome data using GATK pipeline. I installed circos on linux platform. I understand from circos tutorial that it needs conf. …
-
How to plot a dendrogram with images of RNAstructure at the leaves/tips?
written by Michael Dondrup 5.6KBackground: we are clustering some (~500) ncRNAs based on their secondary structure. 2D structure is computed by RNAfold. Then, we compute a distance matrix of …
-
Modelling of proteins
written by shilpa.janarthanan 0My objective is to model a protein for which the experimental structure is not known. I performed homology modeling using Modeller and performed Energy Minimisation …
-
Rfold file form T-Coffee conversion to structure readable format
written by kaur.devbio 0The file generated form R-coffee output an Rfold file which is having structure information. How to open these files? How to draw out structures from …
head -n 50of the RFold file in a GitHub gist please?