Rfold file form T-Coffee conversion to structure readable format

The file generated form R-coffee output an Rfold file which is having structure information. How to open these files? How to draw out structures from Rfold file?

alignment software-error

• 168 views • link

updated 4.3 years ago by Ram

• written 11.5 years ago by kaur.devbio •

0 answers

No answers yet.

More posts like this

Is there a way to visualize RNA fold in R
written 2.9 years ago by Serij´s •

Hi, I am currently using the LncFinder-package in R to predict the secondary structure of RNA. I generated multiple dot-bracket-notations and I was wondering if …
How to convert 10x matrix.mtx.gz files to hdf5 format?
written 4.1 years ago by johnny rocketfingers •

I have a bunch of folders containing barcodes.tsv.gz, features.tsv.gz, and matrix.mtx.gz from the Cellranger Count output for a single-cell dataset that was sent to me …
Annotation of results from CD-HIT web server
written 5.4 years ago by pujaabhaskaranathan7079 •

A lot of output files are generated as a result of cd-hit web server while checking for removal of redundant sequences. Which output file should …
miRNA predictions from large set of long non coding RNA
written 7.2 years ago by Bioinfonext

I have de novo assembled transcript using Trinity. After annotation with nr database and Coding potential filtering, I have around 10,000 transcripts which can be …
CHIMERA: How do I open multiple PDB files in seperate windows (Mac OS X).
written 8.2 years ago by alexille5640 •

I'm running Chimera on my mac. When I have a protein structure from a PDB file open and running, and I try to open a …
How can I use BALIBASE as a benchmark (on line)
written 8.5 years ago by sallyzaki70 •

Earlier I asked a question of how i compare between(clustal/t-coffee/muscle) https://www.biostars.org/p/297397/ my work will be on line <br> 1-i used the data set >seq0 FQTWEEFSRAAEKLYLADPMKVRVVLKYRHVDGNLCIKVTDDLVCLVYRTDQAQDVKKIEKF …
Circos histogram from SNP.VCf file
written 9.2 years ago by Bioinfonext

I have called SNP in transcriptome data using GATK pipeline. I installed circos on linux platform. I understand from circos tutorial that it needs conf. …
How to plot a dendrogram with images of RNAstructure at the leaves/tips?
written 9.3 years ago by Michael Dondrup

Background: we are clustering some (~500) ncRNAs based on their secondary structure. 2D structure is computed by RNAfold. Then, we compute a distance matrix of …
Modelling of proteins
written 9.5 years ago by shilpa.janarthanan •

My objective is to model a protein for which the experimental structure is not known. I performed homology modeling using Modeller and performed Energy Minimisation …
Rfold file form T-Coffee conversion to structure readable format
written 11.5 years ago by kaur.devbio •

The file generated form R-coffee output an Rfold file which is having structure information. How to open these files? How to draw out structures from …