Hello,
I am using perl and not bioperl because my professor has not shown us how yet. I have to extract a FASTA sequence attached to a user accession number input. E.g, If the user enters YP_02030404.1, the script should get the sequence attached to it. like this:
>gi|170079675|ref|YP_001728995.1| [Escherichia coli str. K-12 substr. DH10B]
MRVSWLESKCDTPFANNLSFISSGSSSSSSFTLASTACRNSCLCSSSIFFQVLRRNCSSNCCSISNVDIS
LSAFSFNRFETSSKMARYNLPCPRSLLAILSPPKCCNSPAISCQLRRCCSGCPSIDLNSSLRISTLERRV
LPFSLWVSNRAKFANCSSLQC
so you are asking us to do your homework? strange place to ask for it. but if you are really trying to learn perl, and as I hate discouraging people from starting off, then I'll suggest you try learning
so if accession entered matches any of the hash keys, then you return its value. this is the answer to your question, although you'll have to find out how to build up these 3 steps using perl.
or sorry..i have code down..im just struggling..
use strict;
my $filename; my $accessionid; my $sequenceid;
print "Please enter in the filename: "; chomp($filename = <STDIN>);
print "Please enter in the accessionID: "; chomp($accessionid = <STDIN>);
open(FILENAME, $filename) or die "cannot open file: $! "; while(<FILENAME>){ if($_ =~ /$accessionid/i) { $sequenceid = $; print "$sequenceid\n"; } my $seq = ''; foreach($) { last if ($ =~ />gi/);
print "$seq\n"; } }
i have code..sorry!!
use strict;
my $filename; my $accessionid; my $sequenceid;
print "Please enter in the filename: "; chomp($filename = <STDIN>);
print "Please enter in the accessionID: "; chomp($accessionid = <STDIN>);
open(FILENAME, $filename) or die "cannot open file: $! "; while(<FILENAME>){ if($_ =~ /$accessionid/i) { $sequenceid = $; print "$sequenceid\n"; } my $seq = ''; foreach($) { last if ($ =~ />gi/);
print "$seq\n"; } }
use strict;
my $filename; my $accessionid; my $sequenceid;
print "Please enter in the filename: "; chomp($filename = <STDIN>);
print "Please enter in the accessionID: "; chomp($accessionid = <STDIN>);
open(FILENAME, $filename) or die "cannot open file: $! ";
while(<FILENAME>){
if($_ =~ /$accessionid/i) { $sequenceid = $; print "$sequenceid\n"; } my $seq = '';
foreach($) { last if ($ =~ />gi/);
print "$seq\n"; } }
i have code sorry..
#!/usr/bin/perl -w
use strict;
my $filename;
my $accession_id;
my $sequence_id;
print "Please enter in the filename: ";
chomp($filename = <STDIN>);
print "Please enter in the accession_ID: ";
chomp($accession_id = <STDIN>);
open(FILENAME, $filename) or die "cannot open file: $! ";
while(<FILENAME>){
if($_ =~ /$accession_id/i) {
$sequence_id = $_;
print "$sequence_id\n";
}
my $seq = '';
foreach($_) {
last if ($_ =~ />gi/);
print "$seq\n";
}
}
Log in to answer this question.
And where is this sequence to be "extracted" from? A local database? A remote database? I suggest you use your initiative and started reading the Bioperl HOW-TOs: http://www.bioperl.org/wiki/HOWTOs. What you want to do is very easy.
Can you only do what your prof. has shown you, or are you an independent mind?