This is a test version of Biostars. For the public version, visit https://www.biostars.org.
How To Find The Amino Acid Which Changed Because Of The Resulting Snp

Hi Everyone

I have a question which might be a simple one for you guys So since i am working on ribosomal protein genes(around 80 in humans), i have managed to extract the snps at various locations in all those 80 genes. These snps are basically genomic in origin and they are coding. I will just show you guys the table.

#bin chrom chromStart chromEnd name   transcript   frame  alleleCount funcCodes alleles    codons       peptides    mol_type     class      function

887  chr22  39708987  39708988 rs2014840  NM_000967    2   2           8,42,       G,T,    GGA,GTA,    G,V,         genomic      single    missense

Now as you can see their is a change of peptide from G(glycine) -> V(valine) for snp rs2014840.

What i am interested in is the fact that i need to find where this change is actually occurring in the peptide seq. In other words i want to know which Glycine(G) residue gets changed to Valine(V).

I am making my question more clear.

Now suppose i have a seq of Amino Acids

MACARPLISVYSEKGESSGKNVTLPAVFKAPIRPDIVNFVHTNLRKNNRQ
PYAVSELAGHQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCR
GGRMFA

Now what i want to know is which G(glycine) in the above seq is changing into V(valine)

I have a huge list of my genes and each genes have snps like these.

It would be very nice of you to help me out in this..

Regards

snp mutation position
• 1,974 views • link
updated by Pierre Lindenbaum Pierre Lindenbaum • written by Varun Gupta Varun Gupta

Hi Varun, this kind of question has been asked many times on biostar. Search biostar for mutation+prediction

• 0 views • link
written by Pierre Lindenbaum Pierre Lindenbaum

Hi Pierre Thanks for replying. I will look to those things you told me. Hope i find it. But in case i don't get the exact solution shall i ask you again

Regards Varun

• 0 views • link
written by Varun Gupta Varun Gupta

0 answers

No answers yet.

Log in to answer this question.

More posts like this