Thanks for your help, it solved my problem.
I would like to extract the peptide sequence of the following: NM_021969.2 from the NCBI website as shown in this link: https://www.ncbi.nlm.nih.gov/nuccore/NM_021969.2
I was able to extract the nucleotide sequence using the following script, but I am unable to extract the following peptide sequence:
MSTSQPGACPCQGAASRPAILYALLSSSLKAVPRPRSRCLCRQH RPVQLCAPHRTCREALDVLAKTVAFLRNLPSFWQLPPQDQRRLLQGCWGPLFLLGLAQ DAVTFEVAEAPVPSILKKILLEEPSSSGGSGQLPDRPQPSLAAVQWLQCCLESFWSLE LSPKEYACLKGTILFNPDVPGLQAASHIGHLQQEAHWVLCEVLEPWCPAAQGRLTRVL
LTASTLKSIPTSLLGDLFFRPIIGDVDIAGLLGDMLLLR
Python script:
Entrez.email = 'myemail@gmail.com'
handle = Entrez.efetch(db='nuccore', id='NM_021969.2', rettype='fasta')
print(handle.read())
I would appreciate some help if anyone has succeeded.
Yuval
2 answers
Hi! Welcome to Biostars :).
Try this:
Entrez.efetch(db="protein", id='NM_021969.2', rettype="fasta")
A small educational note: if an answer was helpful, you should upvote it; if the answer resolved your question, you should mark it as accepted. You can accept more than one answer if they all work. If an answer was not really helpful or did not work, provide detailed feedback so others know not to use that answer.

Hi,
You can use NCBI Datasets. To download the protein sequence associated with this nucleotide record, you can use the following command:
datasets download gene accession NM_021969.2 --include protein
This command will download a zip file, with the following contents:
ncbi_dataset
`-- data
|-- data_report.jsonl
|-- dataset_catalog.json
`-- protein.faa
By default, NCBI Datasets gene data package includes transcript and protein sequences, as well as metadata as JSON-Lines. You can include other files (if available) using the flag --include, as exemplified above.
Feel free to reach out if you have any additional questions. I hope it helps :)
Log in to answer this question.