Sorry, the column didn't had a name when I copy from text file.
I have tried it and it works great.
Thanks
Hello I will like to know how can I extract multiple fasta sequences from a file that have a list of the IDs (133 in total) I want to extract. I have started by loading my fasta and ID file in R:
library("seqinr")
fastafile<- read.fasta(file = "proteins.fasta",
seqtype = "AA",as.string = TRUE, set.attributes = FALSE)
head(fastafile)
$`1.1.1.m1`
[1] "MRRRGQWWFTAETSVGQTANTSANSDLLSPAFWLVRGHEFKITRSDDPQHTALLQTSDDCLGGQTFRAKITSYGRFTERESWEIKPNVDGCRGSCNVSYAGRFEETVGFKQAKCSSRIQSEKNIGFWCAIGSRGSVMMIGGGGKPCTLGDHGIGITNAKDRSFSHSPSSKRNDFGDVATSSPETSYSLNLWIQ"
$`1.1.2.m1`
[1] "MHEHTSQSVACGAQTEEVLRSITMRRKTNYQTATTCLVKLIFEHVLNVRKTNSIEKFDGLEARHRKHIKEIVALEINPNSFGISERQGPIPQPVILFPLNAEYQARDVKNRTAPGIPSGVSLAPGPNGEKDGSYEFFGNTNSFIEFPNSPRGALDVLYSITILCWVYYDEKGGPHGLIFEYNTGGKYGVHLWVVNRLFSARFIDRAFSYSRPYLRHTSLAGGWKFVGASYDNETGEIKLWADGA"
co2=read.table("trt_co.csv",header=T, sep=",")
head(co2)
1 1.1.10073.m1
2 1.1.10395.m1
3 1.1.10428.m1
4 1.1.10509.m1
5 1.1.10621.m1
6 1.1.10760.m1
I will appreciate your help on what would be the next step.
Thanks
You don't say what the column in co2 containing the IDs is called, but let's assume that it is named ids.
Then you can simply subset the list fastafile like this:
fastafile[names(fastafile) %in% co2$ids]
Sorry, the column didn't had a name when I copy from text file.
I have tried it and it works great.
Thanks
Hey,
Sorry I am new to R. After entering the line of code:
fastafile[names(fastafile) %in% list$ids
R returns the following:
named list()
Can anyone explain this to me?
This doesn't work because the fasta format is a list of the id, ali and call for that set of data. When you try to subset this way, it is trying to find the list of sequences you want in the list that is currently [id, ali, call], so it gives you an empty result (since none of your sequence names match those objects).
I did this instead, creating a new fasta object with the subsetted alignment object (the second object in the fasta list) that I took out of my original fastafile.
newfastafile=fastafile(fastafile$ali[fastafile$id %in% list$ids,])
I was encountering the same problem.
OK so I did this and I get an error that says fastafile is not a function so is fastafile that is outside of the () just supposed to be calling the object created earlier?
Log in to answer this question.
You use read.table(header = T), but head(co2) does not show column names? Or did you just omit them from this post?
I'm just curious, why would you do that in R?
One reason: because your downstream analysis is most easily performed in R. The seqinr package contains a lot of useful functions for statistical analysis of sequences; reading them in is just the first step.
In which program would you advice doing it?
I would extract them before I load it into R, for example using 'grep' (if your fasta hast sequences in just one line) some script pyhton/bash/perl....
if you are on a linux machine you can also go with kent source utils: kent source. There is a lof of usefull stuff in your case look at "faSomeRecords".