Question

Amino Acid Composition-Graphic Representation

0

Entering edit mode

10.3 years ago

williamjohn360 ▴ 90

Is there any tool to create graphic representation of amino acid composition like in predictprotein.org? I understand it can be easily created in excel, but it will be good if any tool available online. enter image description here

amino-acids graphs visualization • 3.9k views

ADD COMMENT • link updated 10.3 years ago by secretjess ▴ 210 • written 10.3 years ago by williamjohn360 ▴ 90

0

Entering edit mode

You expect us to register at some site just so we might get an idea of what it is that you actually want to do?

ADD REPLY • link 10.3 years ago by 5heikki 11k

0

Entering edit mode

Now I have added the image

ADD REPLY • link 10.3 years ago by williamjohn360 ▴ 90

score 3 · Answer 1 · 2013-12-20

3

Entering edit mode

10.3 years ago

secretjess ▴ 210

In R:

rand_seq <- "WYEGYQERKMKKNLLGYEQMLRSDFMNTMHPHEDTWICWDYALNQIALNPKTWKVQKSCKASLMPTVDSMYFWYIAHMEMKMQYEWTEWFIHVPYFFDRCFVWYDEFCCQVCMAFLERFRDTNQSSGQLCAWVGYLKNIGYSHYISTILYRYPQEYNIVPTWNIAIMHMQDKVDVECKLNKSMSEHCHHHFPLLAYIDFPLWKPNIYKSPWLMDPFMANLA"

aa_tab <- table(strsplit(rand_seq,""))

pie(aa_tab, col=rainbow(length(aa_tab)), main="Amino Acid Composition")

Unless you didn't mean the pie chart, in which case I can't help, sorry!

simple pie chart

ADD COMMENT • link 10.3 years ago by secretjess ▴ 210

0

Entering edit mode

Basically this but with ggplot2, which makes much prettier graphs IMO.

ADD REPLY • link 10.3 years ago by 5heikki 11k