Amino Acid Composition-Graphic Representation

Is there any tool to create graphic representation of amino acid composition like in predictprotein.org? I understand it can be easily created in excel, but it will be good if any tool available online. enter image description here

amino-acids graphs visualization

• 4,811 views • link

updated 12.6 years ago by secretjess

• written 12.6 years ago by williamjohn360

You expect us to register at some site just so we might get an idea of what it is that you actually want to do?

• 0 views • link

written 12.6 years ago by 5heikki

Now I have added the image

• 0 views • link

written 12.6 years ago by williamjohn360

1 answer

In R:

rand_seq <- "WYEGYQERKMKKNLLGYEQMLRSDFMNTMHPHEDTWICWDYALNQIALNPKTWKVQKSCKASLMPTVDSMYFWYIAHMEMKMQYEWTEWFIHVPYFFDRCFVWYDEFCCQVCMAFLERFRDTNQSSGQLCAWVGYLKNIGYSHYISTILYRYPQEYNIVPTWNIAIMHMQDKVDVECKLNKSMSEHCHHHFPLLAYIDFPLWKPNIYKSPWLMDPFMANLA"

aa_tab <- table(strsplit(rand_seq,""))

pie(aa_tab, col=rainbow(length(aa_tab)), main="Amino Acid Composition")

Unless you didn't mean the pie chart, in which case I can't help, sorry!

simple pie chart

• 204 views • link

written 12.6 years ago by secretjess

Basically this but with ggplot2, which makes much prettier graphs IMO.

• 0 views • link

written 12.6 years ago by 5heikki

More posts like this

How to analyze the ProDom output? I have some results to support the analysis, but I don't have the…
written 12.1 years ago by dssouzadan •

Hi all, I have some results retrieved from ProDom database and I need to analyze the output from 3 inputs to check if they share …
Fastqc, Trimming And Kmers
written 12.3 years ago by int11ap1

Good morning everybody, I had RNA-seq data from Illumina (paired-ends), which adapters were removed and quality trimming performed successfully using Trimmomatic. After analysing with FastQC, …
What Software Can Be Used To Make A Plot Of Abberations As Shown?
written 12.7 years ago by merajazizmeraj •

Does anyone know what software was used to make plots like the following: <img src='http://s2.postimg.org/vjfm7l2d5/Screen_Shot_2013_11_25_at_10_22_03_PM.png' alt='enter image description here' />
Local Alignment Of Rna-Seq Data
written 12.9 years ago by Nicolas Rosewick

Hi, Anyone knows a good tool to align RNA-Seq data in local alignment mode ? The tool has to be splice-aware. Example (in red: aligned …
Represent Rnaseq Figure Similar To One Represented In Paper
written 12.9 years ago by k2bhide

Hello all, I would like to know which software or tool can be used to generate figure similar to one mentioned below <img src='http://s7.postimg.org/87vshbunf/example.jpg' alt='enter …
Is There Any Software That Can Be Used To Draw A Gene Order Figure?
written 12.9 years ago by Cacau

Is there any software that can be used to draw a gene order figure like this one<img src='http://www.pnas.org/content/104/35/13948/F5.large.jpg' alt='enter image description here' /> or this …
Are There Some Nextera Barcodes / Adaptors Left?
written 12.9 years ago by mazzottidr •

Dear all, I've just got some Illumina exome data from MiSeq (Nextera capture) and got the following fastqc results. Would someone give feedback on what …
What Should I Do With This K Mer Content Result As Followings? Should I Give Up Using It?
written 12.9 years ago by Tonyzeng •

<img src='http://s6.postimg.org/r4rcab4hd/Kmer_content.png' alt='enter image description here' />
Count 5'End Mapped To A Specific Genomic Position
written 12.9 years ago by ifreecell

I got several <a href='http://samtools.sourceforge.net/SAM1.pdf'>SAM</a>/BAM files, and I am interested in 5'ends of the mapped reads. Is there any tools or scripts to count how …
Convert Cdna To Amino Acid Iteratively 3 Base Pairs At A Time?
written 13.2 years ago by Hmm •

How can i iteratively go through a cDNA sequence in both directions of a genomic location three bases at a time and stop on an …