More posts like this
-
Continuing issues with MAKER and SNAP
written by mrmrwinter •Hi, I am trying to annotate my assembly using MAKER. My plan was to run it first with EST2genome and protein2genome, using fastas to inform, …
-
to grep pattern
written by sherafzalk769 •I am interested to grep the line only containing the word "gene" present at column 3 of this following file but this word is also …
-
Error in gff file
written by sherafzalk769 •I am trying to use gff with bedtools intersect to get the reads count to the gene. However, it is throwing an error: ``` Error: …
-
htseq-count settings for differential expression
written by candron •Hi All, I am doing a differential gene expression analysis with samples form a non-model plant species, Nicotiana benthamiana. I am now at the step …
-
How to repair a gff/gtf file that is missing gene id, gene name, and transcript name?
written by O.rkaI am trying to run the `TagReadWithGeneFunction` tool from https://github.com/broadinstitute/Drop-seq and it requires my `gtf` file to have `gene name`, `gene id`, `transcript name`, and …
-
how to change the sequence ID and order of sequences in a file to match an alignment output file
written by Kay •Hi, I have two files, one is protein sequences of a group of genes, and the other is their corresponding nucleotide sequences. >maker-scaffold10x_338_pilon-snap-gene-0.71-mRNA-1 MHLKNGDPKPTIKPNQCTLFGFRFCPYVDRVRMVLQYYNVPHDNVWIHLYSKPDWYLELY PVGKVPLLITKEGKTIVESDAIIRYLDETIGNKSLMSLCGEAEFERAGKLASKLMAQSHG …
-
Easy way to merge several gff output from maker
written by RoxHi everyone ! I'm still struggling on maker. What I want to do, is to follow step by step the maker tutorial for Snap training …
-
Maker Annotation: How to put multiple HMM mod file in maker_opts.ctl?
written by allyson1115ar •I would like to know how to write the command that takes multiple gmhmm mod file in maker? An example of command that takes a …
-
Better strategies for repeat masking?
written by Philipp BayerI'm using MAKER to annotate all of my plant genomes on a single server, and the biggest bottleneck is RepeatMasker with RepBase. I'd say about …
-
replace headers in a fasta file
written by nicolas.dussex •Hi, I would like to replace the first filed my headers in my fasta file and concatenate it to the 2nd field (my gene ID), …