alright , thankyou for response.
I am using biopython for converting my aligned sequence file from one format to another using "AlignIO.write" function. The thing I want to know is that,
- When I convert a sequence file given in phylip format to a file of clustal format, the resulted clustal file is of version
CLUSTAL X (1.81)while I want an output in the form of CLUSTAL W / CLUSTAL 2.1 or so (higher version of clustal). - The resulted clustal file does not include the line in the alignment with symbols (
'*','.',':') for the amino acids in the sequence file.
This is the resulted file I am getting.
CLUSTAL X (1.81) multiple sequence alignment
Canis REWSSARPERSKGRRKPVDAAAVSAVQTSQTSSDVAVSSSCRSMEMQDLTSPHSRLSGSS
Mus -------------------------------------------MEMQDLTSPHSRLSGSS
Rattus -------------------------------------------MEMQDLTSPHSRLSGSS
While this is the file format I want to get, including the symbols line indicating the similarity of the residues.
Canis REWSSARPERSKGRRKPVDAAAVSAVQTSQTSSDVAVSSSCRSMEMQDLTSPHSRLSGSS
Mus -------------------------------------------MEMQDLTSPHSRLSGSS
Rattus -------------------------------------------MEMQDLTSPHSRLSGSS
*****************
Can I do this with biopython or I have to use some other method or function??
1 answer
According to the documentation, BioPython does not yet support writing to Clustal 2 formats.
You can try scripting it yourself, or simply realign with clustal and output the format directly.
In case anyone is looking to do this in a scripted manner, I too Joe's suggestion "You can try scripting it yourself" already and made it so the symbols get added to a Clustal alignment that lacks them. See the script calculate_cons_for_clustal_protein.py described here and includes links to a demonstration Jupyter notebook that can be run directly in your browser via MyBinder.
Log in to answer this question.
Hello mdsiddra,
could you please also provide an example of the phylip input file?
fin swimmer
Yes, This is how a phylip file look like:
Hi,
I think seqret from EMBOSS can do the job. You can set the output format as clustal.
I don't want it this way. As I am using python/biopython codes, so I wish to use some source code for this purpose.
What version of Biopython are you on?
Python 3.6 and biopython 1.72