This is a test version of Biostars. For the public version, visit https://www.biostars.org.
How To Generate Pssm File From One Protein Sequence?

for example, I use one seq. from one of RS126 that filename is "1acx.concsie" , the id is "lacx" , the seq. is

APAFSVSPASGASDGQSVSVSVAAAGETYYIAQCAPVGGQDACNPATATSFTTDASGAASFSFTVRKSYAGQTPSGTPVGSVDCATDACNLGAGNSGLNLGHVALTFG

How can I use them to generate pssm files? 1. Parsing web site by perl 2. Get one program that can generate pssm file in local pc in Linux system

pssm perl python

0 answers

No answers yet.

Log in to answer this question.