This is a test version of Biostars. For the public version, visit https://www.biostars.org.
Modifying fasta header

I have strange fasta headers like this for some good number of sequences,

>gi|61221638|sp|P0A366.1| >gi|61221640|sp|P0A368.1|CR1AA_BACTE RecName: Full= protein synthase>gi|40267|emb|CAA31886.1| unnamed protein product
HTSIDGRPINQGNFSATMSSGSNLQSGSFRTVGFTTPFNFSNGSSVFTLSAHVFNSGNEVYIDRIEFVPAEVTFEAEYDLERAQKAVNELFTSSNQIGLKTDVTDYHIDQVSNLVECLSDEFCLDEKQELSEKVKHAKRLSDERNLLQDPNFRGINRQLDRGWRGSTDITIQGGDDVFKENYVTLLGTFDECYPTYLYQKIDESKLKAYTRYQLRGYIEDSQDLEIYLIRYNAKHETVNVPGTGSLWPLSAQSPIGKCGEPNRCAPHLEWNPDLDCSCRDGEKCAHHSHHFSLDIDVGCTDLNEDLGVWVIFKIKTQDGHARLGNLEFLEEKPLVGEALARVKRAEKKWRDKREKLEWETNIVYKEAKESVDALFVNSQYDQLQADTNIAMIHAADKRVHSI

I would like to replace the other (>gi) in the fasta header to blank or ;. Can anyone suggest how to do it. I have many such sequences in a big fasta file.

awk perl sed unix python

1 answer

If the symbol before the second > is a space, just:

cut -d ' ' -f 1 in.fasta > out.fasta

But imho, if your fasta headers are broken, you'd better check your upstream workflow

The space thing worked. Thanks for the tip. I just substituted in vim using space . Unfortunately i cannot change the upstream flow as this itself is starting file which was given to me.

You should at least inform whoever gave it to you that what they gave you was not valid fasta. This kind of error is just a waste of everyone's time and should be fixed.

Log in to answer this question.