Comparison of NGS-Platform Manufacturers

Hi there,

does anyone of you guys know a source for a comprehensive comparison of today's sequencer manufacturers. What I have in mind is some kind of table with facts about: costs, read length, depth, error-rates, run-time etc...

Any guidance is highly appreciated...

Best

Phil

ngs technology

• 2,888 views • link

updated 12.2 years ago by Devon Ryan

• written 12.2 years ago by Phil S.

2 answers

https://docs.google.com/spreadsheet/ccc?key=0AvaxS3m5rl-9dHdtUGRtaGlsZWNFNWJleDRXaUhQTHc&hl=en_GB#gid=0

• 0 views • link

written 12.2 years ago by 14134125465346445

very useful info.

• 0 views • link

written 12.2 years ago by Prakki Rama

Where did the ball park figure for the GridIon system come from in that table? I haven't seen anything on pricing for Oxford Nanopore other than an estimate of around $900 for the MinION system and that the GridION would have several pricing schemes available.

• 0 views • link

written 12.2 years ago by DG

Few days back I was going through this paper to get an idea.

• 0 views • link

written 12.2 years ago by Prakki Rama

you can have a look also comment about this paper http://www.nature.com/nbt/journal/v31/n4/pdf/nbt.2522.pdf

• 0 views • link

updated 6.6 years ago by Ram

• written 12.2 years ago by HG

More posts like this

How to trim transcripts using information from NCBI contamination screen report
written 2.3 years ago by Lada •

Hi guys, so I decided to upload my transcriptomes (non model animals without reference genomes) to TSA but obviously I didn't do a good job …
Blog: NGS one-liner to call variants
written 2.8 years ago by barslmn •

Edit 24 Oct 2023: I use nextflow in projects. This is just a curiosity and should be treated as just experimentation. Take a look at …
DESeq2 multiple group comparison
written 7.6 years ago by dazhudou1122

Dear Biostars community: I ran into a question when I was doing RNA-seq analysis using DeSEQ2. I have 4 groups, 3 samples per group, and …
GATK GenotypeGVCFs output is empty gvcf file
written 8.4 years ago by GK1610

I ran java -Xmx48g -jar gatk/3.5-0/src/GenomeAnalysisTK.jar -T GenotypeGVCFs -R hg19/hg19.fa -V merged.240samples.chr22.gvcf.gz -o merged.jointGT.chr22.gvcf.gz it got successfully completed INFO 20:18:40,706 ProgressMeter - Total runtime 9474.26 …
Modeling Cancer/Disease Progression
written 9.6 years ago by arudhir •

I am trying to do bioinformatics work for the first time with [this][1] competition. I am completely lost as to how to proceed and I …
Need help with SortMeRNA error
written 11.3 years ago by sentausa

Dear all, I am using SortMeRNA version 2.0 to filter out rRNAs from my metatranscriptomics data and I got an error message: ERROR: '1' is …
How to verify the information stored in a GFF file
written 11.8 years ago by iraun

Hi all, I've just created a new GFF off a new version of a genome X using liftOver tool. I would like to know any …
Genomic Coverage - Samtool's undocumented "depth" verses the poorly documented pileup.
written 12.0 years ago by John

Hey all :] I use samtools's depth, and occasionally samtool's pileup commands to calculate coverage of my reads to the genome before binning for coverage. …
Naming of FastA sequences
written 12.2 years ago by Phil S.

Hi there, I have a usual looking fastA file like this: <pre> >Translation: 2..112 (direct), 37 amino acids ADTAQEFISTAVFGTSMSAHHILGLKPVPRVWLFAI* >Translation: 1482..1790 (direct), 103 amino acids …
Normalize Metagenomic Quantification Counts.
written 12.7 years ago by Phil S.

Hi guys, I have a rather complex or maybe to some of you naive question. I go Illumina pe 100bp sequencing which targeted human DNA. …