This is a test version of Biostars. For the public version, visit https://www.biostars.org.
Retrive amino acids sequences from NCBI E-Direct

Hi all,

I have just finished to analyse for the first time an RNAseq dataset with DESeq2 for Verticillium dahliae. I have obtained a .csv file where there are more 6000 Gene_ID and now I would like to use the Gene_ID to retrive the corresponding amino acid sequences from NCBI E-Direct, in fasta format. I have tried to use the following code:

esearch -db nuccore -query VDAG_00XXX | elink -target protein | efetch -format fasta

However, when I run the before mentioned code, I do not get the amino acid sequence for the protein but for 1660 other proteins (including the one I have searched for). Because I have a long list of genes that I would like to submit in NCBI E-Direct, do you know how I can retrive the excat gene/protein from it?

Also, I was looking at the NCBI website and noticed that the Gene_ID I got on the .csv file, it is called Locus_Tag. Can I still use it in my reasearch?

Thanks!

e-direct
• 1,455 views • link
written by Patadu94 • Patadu94

I found this old post and I was able to retrive a single amino acid sequence for the Gene_ID (Locus_Tag) that I include in the -query. However, when I use this code:

epost -db gene -input "PATH/to/Folder/file.txt" | elink -target protein -name gene_protein_refseq | efetch -format fasta_cds_na

I do get error and as a result I get amino acids from Homo Sapiens. Any suggestion on how to obtain the amino acid sequences I have included in my .txt file?

• 0 views • link
written by Patadu94 • Patadu94

Hi GenoMax

Thanks, in the end I could manage to make NCBI EDirect run on the Linux Command Line. I have used the same code as above but I have chose efetch -format fasta as an output. I could get the AA sequnces from that and run them in EffectorP

• 0 views • link
written by Patadu94 • Patadu94

This should have worked though (one example)

$ esearch -db gene -query VDAG_00101 | elink -target protein -name gene_protein_refseq | efetch -format fasta_cds_aa
>lcl|XM_009651478.1_prot_XP_009649773.1_1 [locus_tag=VDAG_00101] [db_xref=GeneID:20701564] [protein=MYG1 protein] [protein_id=XP_009649773.1] [location=167..1180] [gbkey=CDS]
MSTLTIGTHNGHFHADEALAVHMLRQLPAYQGASLIRTRDPKLLETCHTVVDVGGEYDAEKNRYDHHQRD
FTTTFPGRSTKLSSAGLVFLHFGRAIIAQKMGTAEDSPDVALLHNKFYESFIEALDAHDNGISVYDHLAV
• 0 views • link
written by GenoMax GenoMax

Definitely that works. When I use a single VDAG ID I have no problem, but with the .txt file I had to convert the IDs and then run it. Anyway, I did get the AA list I was looking for.

• 0 views • link
written by Patadu94 • Patadu94

0 answers

No answers yet.

Log in to answer this question.

More posts like this