This is a test version of Biostars. For the public version, visit https://www.biostars.org.
Pal2nal translation of large multi-fasta files produces a codon translated file where some sequences half length of the average.

I did sequence alignment of a large peptide multi-fasta (n= 4991 sequences). The peptide alignment has sequences with the same length and pal2nal went through just fine... except some of the codon sequences are at half length. If average is X then some sequences are X/2. This is choking IQ-Tree.

I have tried both MUSCLE super5 and MAFFT. The error remain the same (i.e. MUSCLE or MAFFT both lead to some sequences having half of average length) except for different average lengths and average half length in MUSCLE and MAFFT codon sequences. I have pulled out and played with the sequences causing the issue and they seem to be in frame.

Example of peptide sequence not causing an issue:

RKVEAFLLFKEMGERGCQPNVHTYTVLIDSFCKERNLDDARKLFDDMFKKGLVPSVVTYNALIDGYCKEGMTEAALEILGMMESKKCNPNARTYNELICGFCKAK

corresponding cds :

AGGAAAGTGGAAGCTTTTCTACTTTTTAAAGAAATGGGTGAAAGAGGTTGTCAGCCTAATGTTCATACATACACTGTGCTTATTGATTCCTTCTGTAAGGAAAGGAATCTTGATGATGCCAGGAAATTGTTTGATGACATGTTTAAGAAAGGTTTGGTTCCCAGTGTGGTCACTTATAATGCTTTAATTGATGGGTATTGTAAAGAGGGAATGACTGAAGCTGCATTAGAAATTTTAGGTATGATGGAATCAAAGAAATGCAACCCTAATGCTCGGACCTACAATGAATTGATCTGTGGATTTTGTAAAGCTAAA

Example of peptide causing issue:

GLCKGGRLNDAWEIFQYLLAKGYQLNVHTYNAMVHGFCKEGLLDEAISLLYKMEENGCVPNSVTFNVVL

corresponding cds

GGTTTGTGCAAAGGTGGTAGATTAAATGATGCGTGGGAGATTTTTCAGTATCTTTTAGCGAAAGGTTATCAACTAAATGTCCATACATATAATGCGATGGTTCATGGTTTTTGCAAAGAAGGTTTGCTTGATGAAGCAATCTCCCTGCTTTATAAAATGGAAGAGAATGGTTGTGTCCCTAATTCTGTAACTTTTAATGTAGTCCTT

Any idea what might be going on?

translation codon phylogenetics

0 answers

No answers yet.

Log in to answer this question.