How to retrieve non-redundant restriction enzymes database from Rebase?
http://rebase.neb.com/rebase/rebase.files.html
All I find here are lists that contain repeated enzymes.
rebase
databases
enzymes
restriction
• 620 views
•
link
written
by
Mahmoud Reda
1
0 answers
No answers yet.
Log in to answer this question.
More posts like this
-
HMM gets zero or 1 hits when many more expected
written by Gio 2Hi all, My ultimate goal is to understand the phylogeny of a set of restriction-modification enzymes among certain genomes. For this, I have done the …
-
How do i figure out whether a recognition site is conserved or not?
written by Mahmoud Reda 1I have two sequences corresponding to the 16s rRNA gene for two strains of a certain species. I simulated the restriction digestion of these sequences …
-
Extract fastq reads by lists of sequences
written by dlekrud456 0Hello, I have lists of sequence which I would like to find fastq reads that contain these sequences. Is there a tool or any possible …
-
Permutation test (randomisation test)
written by shadboltjessica 1Hello everyone, undergrad here. I am looking for some advice concerning my approach for a simple permutation test. I have a list of 1000 mesophyll-specific …
-
EggNOG classes - What are they? e.g. bacNOG vs bactNOG
written by NickJD 0There are many different COG classes. This page here lists many but without explanation and I can not find any definition for the classes anywhere: …
-
How to find the overlapping peptide from a list.
written by Anisur Rahman 8I have the following sequence; **IRCIGVSNRDFVEGMSGGTWVDVVLEHGGCVTVMAQDKPTVDIELVTTTVSNMAEVRSYCYEASISDMASDSRCPTQGEAYLDKQSDTQYVCKRTLVDRGWG NGCGLFGKGSLVTCAKFACSKKMTGKSIQPENLEYRIMLSVHGSQHSGMI** I used three tools/methods from the Immune Epitope Database (IEDB) to predict antigenic peptides from this sequence. So, …
-
With Python, how can I solve this restriction mapping problem?
written by francois 9I'm struggling with the following Python project, which I'll call **multi-digest restriction mapping**. It is originally a bioinformatic problem, but you really do not need …
-
restriction enzyme in REBASE
written by nora 4when I used the software pDRAW32 for virtual sequence analysis by restriction enzymes, I observed that he mentioned that there is an ezyme named att1, …
-
Determine identify of protein domains in a fusion protein
written by elkington 0<p>I have a list of fusion proteins that contain domains similar to known enzymes; however, other portions of the fusion proteins are not similar to …
-
Identifying repeated genes from multiple lists
written by Megatron 1Hello, I have 25 lists of genes. On each list, there are anywhere from 1-50 genes I want to process these lists to find, between …