This is a test version of Biostars. For the public version, visit https://www.biostars.org.
UniProt protein amino acid

Hello I have tblastn results (for 2 fasta files), I dont know how to locate the aligned subject protein sequence. how should I use this sequence to identify the corresponding integrase protein record in UniProtKB. (I want to find one with 100% identity).

I want to use UniProt to compare human IGRP protein and the integrase that is an IGRP-mimic.

Can anyone help me with this? I am stuck.

sequence protein uniprot

Can you give example sequences? What are you starting with what are you getting. What step exactly you are stuck at?

Hello thanks for responding. I dont know what approach to take.

This is my reslut from tBLASTn:

saccver Subject accession dot version (database hit): NODE_513_length_2816_cov_3.16407
qstart  Start of alignment in query:1
qend End of alignment in query:108
sstart  Start of alignment in subject (database hit):526
send End of alignment in subject (database hit): 203
sallseqid   All subject Seq-id(s), separated by a ';' : NODE_513_length_2816_cov_3.16407

qseq    Aligned part of query sequence:
MDKIRYRLVYNRQKKLNKQGTAFVQIEAYLNQRKIYLKTNVYLKPECWSREGAQVINHPQSNELNAMLYEYILYLQGIELGYWKRGIPATLSLLKDAVKKKSAVNISF

sseq    Aligned part of subject sequence:
MDKIRYRLVYNRQNTLNRQGTTLVQVEAYLNQRKIYLKTNVYLKPECWSREGAQVINHPQSNELNAMLYEYILYLQGIELGYWKRGIPATLSLLKDAVKKKSAVNVSF

1 answer

You can use this link to convert GenBank Accession IDs to UniProt IDs. You could find GenBank accession numbers by BLAST and search corresponding UnitProKB. However, I am not sure if all the GenBank IDs are represented in UnitProKB.

Looks like you could also do Unitpro BLAST in Uniprot directly. Your first protein seq returns hits.

Thanks you for responding. I found a way for this but I am not sure if it is right way. I just BLAST for the subject sequence and found 2 protein name with 100% identity. one was the Integrase I wanted.

Log in to answer this question.