This is a test version of Biostars. For the public version, visit https://www.biostars.org.
How to download fasta sequence of my interest from NCBI?

Hi all,

I am trying to download the protein fasta sequence of "HSP listeria monocytogenes" from NCBI. Please suggest how I can download these all sequences using the command line from NCBI. I tried the following command, however it requires a file of accession number but since I have a keyword (HSP listeria monocytogenes) to search and retrieve the sequences in fasta format.

Please help me to find the way in this regard.

epost -db protein -input <Accessions file>  | efetch -format fasta  > <Output file>
ncbi fasta
• 1,488 views • link
updated by Ram Ram • written by Kumar Kumar

1 answer

While this can be done via NCBI Entrez web search followed by a download, if you still want to use Entrezdirect then something like following would work.

$ esearch -db protein -query "HSP AND listeria monocytogenes [orgn]" | efetch -format fasta

Representative result (sequences truncated for space saving)

>sp|Q71Z71.1|RS4_LISMF RecName: Full=30S ribosomal protein S4
MARYTGPSWKVSRRLGISLSGTGKELERRPYAPGQHGPTQRKKISEYGLQQAEKQKLRHMYGLTERQFKN

>WP_052960683.1 30S ribosomal protein S4 [Listeria monocytogenes]
MARYTGPSWKVSRRLGISLSGTGKELERRPYAPGQHGPTQRKKISEYGLQQAEKQKLRHMYGLTERQFKN

>WP_031665574.1 30S ribosomal protein S4 [Listeria monocytogenes]
MARYTGPSWKVSRRLGISLSGTGKELERRPYAPGQHGPTQRKKISEYGLQQAEKQKLRHMYGLTERQFKN
• 0 views • link
written by GenoMax GenoMax

That is great! Thank you for your help.

• 0 views • link
written by Kumar Kumar

Log in to answer this question.

More posts like this