Thank you @Mensur Dlakic.
I need to parse accessory gene sequences (both dna and amino acid sequences) from roary pangenome output. I have the locus_tag list and their corresponding gbk and gff files, Is there any way to extract both amino acid and dna sequences from the gbk or gff files.The gbk and gff file were generated through prokka pipeline. Is there any tool to do the same.
The roary accessory genes locus_tag list and corresponding strain gbk and gff file samples are shown below,
locus_tag list.csv
locus_tag/Pcissicola19
xynB_1 BGDHLHFA_02833
smpB BGDHLHFA_01427
Pcissicola19.gbk
gene complement(39965..40852)
/gene="xynB_3"
/locus_tag="BGDHLHFA_02833"
CDS complement(39965..40852)
/gene="xynB_3"
/locus_tag="BGDHLHFA_02833"
/EC_number="3.2.1.37"
/inference="ab initio prediction:Prodigal:002006"
/inference="similar to AA sequence:UniProtKB:P36906"
/codon_start=1
/transl_table=11
/product="Beta-xylosidase"
/protein_id="Prokka:BGDHLHFA_02833"
/translation="MPELLAFVAKHKLPIDFVTTHTYGVDGGFLDENGKQDTKLSASL
DAIVGDVRRVRAQIQASPFPNLPLYFTQWSSSYTPRDFVHDSYISAPYILTKLKQVQG
LVQGMSYWTYTDLFEEPGPPPTPFHGGFGLMNREGIRKPAWFAYKYLHALKGRDVPLS
DAHSLAAVDGTRVAALVWNWQQPMQAVSNTPFYTKQVPATDSAPLRMRMTHVPAGTYQ
LQVRKTGYRRNDPLSLYIDMGMPKDLAPRQLTQLRQATHDAPEQDRRVRVGADGVVEI
NVPMRSNDVVLLTLEPAAR"
Pcissicola19.gff
ID=BGDHLHFA_02833_gene;Name=xynB_3;gene=xynB_3;locus_tag=BGDHLHFA_02833
gnl|Prokka|BGDHLHFA_249 Prodigal:002006 CDS 39965 40852 . - 0 ID=BGDHLHFA_02833;Parent=BGDHLHFA_02833_gene;eC_number=3.2.1.37;Name=xynB_3;gene=xynB_3;inference=ab initio prediction:Prodigal:002006,similar to AA sequence:UniProtKB:P36906;locus_tag=BGDHLHFA_02833;product=Beta-xylosidase;protein_id=gnl|Prokka|BGDHLHFA_02833
For your kind reference my datasets having both draft genome and complete genomes.
The expected dna and amino acid sequence output is given below respectively,
>BGDHLHFA_02833
tcagcgcgccgccggctccagcgtcagcagcaccacatcgttgctgcgcatcggcacgttgatctcgaccacgccatcggcgcccacacgcacacgccgatcctgttcgggcatcgtgcgtggcctgtcgcagctgcgtcaactggcgcggcgccaggtccttgggcatgcccatgtcgatgtacagcgacaacgggtcgttacgccgatagccggtcttgcgcacctgcagctggtacgtgccggcaggcacatgggtcatgcgcatgcgcagcggcgcgctgtcggtggcgggcacctgtttggtgtagaacggcgtattgctcaccgcctgcatgggctgctgccaattccacaccagtgcggcgacgcgcgtgccgtccactgcggcgagggaatgtgcgtcgctcagcggcacatcgcggcccttgagcgcatgcaagtacttgtaagcgaaccaggccggtttgcgaatgccttcgcgattcatcagcccaaacccgccgtggaagggcgtgggcggtgggccgggttcttcgaacagatcggtatagtccagtaactcatgccctgcaccaggccctgcacctgcttgagcttggtcaggatgtacggcgcgctgatgtaactgtcgtggacgaaatcgcgcggcgtatagctgctgctccactgggtgaagtacagcggcaggttgggaaatggcgaggcctggatctgcgcgcgcacgcgtcgcacatcgccgacgatggcatccagagatgcggacagcttggtgtcctgcttgccgttctcatcgagaaacccgccatccacgccataggtatgcgtggtgacgaagtcgatcggcagtttgtgcttggcaacgaaggccagcagttccggcac
>BGDHLHFA_02833
MPELLAFVAKHKLPIDFVTTHTYGVDGGFLDENGKQDTKLSASLDAIVGDVRRVRAQIQASPFPNLPLYFTQWSSSYTPRDFVHDSYISAPYILTKLKQVQGLVQGMSYWTYTDLFEEPGPPPTPFHGGFGLMNREGIRKPAWFAYKYLHALKGRDVPLSDAHSLAAVDGTRVAALVWNWQQPMQAVSNTPFYTKQVPATDSAPLRMRMTHVPAGTYQLQVRKTGYRRNDPLSLYIDMGMPKDLAPRQLTQLRQATHDAPEQDRRVRVGADGVVEINVPMRSNDVVLLTLEPAAR
1 answer
prokka makes .ffn and .faa files, which contain codons and their translations, respectively. They should have the same annotations as .gbk files. In this case you don't need to parse anything - just extract the sequences of interest directly from these files.
Log in to answer this question.
Please post example file/lines for better understanding the issue and do not post images of the data.
@cpad0112 I have revised my question. Please go through it.
I recently posted here how to extract aa and nt sequenece (C: How to extract all gene nucleotide sequences separately from multiple Genbank fi) from gbk. What you need to do is extract the locus_tag and loop over those tags and extract only those sequences from gbk.