qBLAST run and Multiple sequence alignment
Hi, I am new to this website and Biopython. I designed the following program and trying to run it with little success as it takes longer to run the program below. I am trying to find matching sequence with an accession number in qblast and parse the .XML results and storing them in a file and finally trying to perform multiple sequence alignment. I run the code below but it takes way too long to run (It does gives valueerror: I/O on closed file, so I used try and exceptions. Can anyone help?
import Bio
from Bio import SearchIO
from Bio.Blast import NCBIWWW
from Bio.Blast import NCBIXML
result_handle = NCBIWWW.qblast("blastp", "nr", ' NP_001090682.1', entrez_query='Xenopus[ORGN]', hitlist_size=5)
with open("my_blast5.xml", "w") as out_handle:
out_handle.write(result_handle.read())
result_handle.close()
blast_qresult = SearchIO.read("my_blast5.xml", "blast-xml")
print(blast_qresult)
for Hits in blast_qresult:
for hit in Hits:
print(hit)
print()
import itertools
import xml.etree.ElementTree as ET
tree = ET.parse('my_blast5.xml')
root = tree.getroot()
import sys
olp = tree.iter("Hit_accession")
mylist = [t.text for t in olp]
ptp= tree.iter('Hsp_hseq')
mylist1 = [t.text for t in ptp]
mylist3 = [ele.replace('-','') for ele in mylist1]
with open("test1.txt", "a") as sys.stdout:
print('>'+mylist[0],'\n'+ mylist3[0])
print('>'+mylist[1],'\n'+ mylist3[1])
print('>'+mylist[2],'\n'+ mylist3[2])
print('>'+mylist[3],'\n'+ mylist3[3])
print('>'+mylist[4],'\n'+ mylist3[4])
print('>'+'Epitope'+ '\n'+'MVKLIESKEAFQEALAAAGDKLVVVDFSATWCGPCK')
from Bio.Align.Applications import ClustalwCommandline
from Bio import AlignIO
try:
cline = ClustalwCommandline("clustalw2", infile="test1.txt")
clustalw_exe = r"C:\Users\XYZ\Downloads\clustalw2.exe"
clustalw_cline = ClustalwCommandline(clustalw_exe, infile="test1.txt")
# assert os.path.isfile(clustalw_exe), "Clustal_W executable is missing"
stdout, stderr = clustalw_cline()
ClustalAlign = AlignIO.read("test1.aln", "clustal")
except ValueError:
pass
• 1,097 views
•
link
0 answers
No answers yet.
Log in to answer this question.