This is a test version of Biostars. For the public version, visit https://www.biostars.org.
Using augustus gene model gff as STAR input

Hi all, I'm trying to do a DGE analysis on a non-model organism that has a published Augustus gff file & accompanying fasta file. I keep getting this error:

terminate called after throwing an instance of 'std::out_of_range'
  what():  vector::_M_range_check
/home/alice/tmp.sh: line 27: 31318 Aborted                 STAR --runMode genomeGenerate --genomeDir $genomeDir --sjdbGTFfile $GTF --genomeFastaFiles $REFERENCE --runThreadN 4

I believe that the gff and fasta may not be labelled the same. I have included a small sample of what the gff and fasta look like.

GFF:

# start gene scaffold1.g8
scaffold1       AUGUSTUS        gene    71594   80958   0.07    -       .       ID=scaffold1.g8
scaffold1       AUGUSTUS        transcript      71594   80958   0.07    -       .       ID=scaffold1.g8.t1;Parent=scaffold1.g8
scaffold1       AUGUSTUS        transcription_end_site  71594   71594   .       -       .       Parent=scaffold1.g8.t1

..

# coding sequence = [atggggaatcgtggaatggaagatttaatccctatcgtaaacaagttgcaagatgcatttgcacaaattggtatagagt

..

# cacgacctccacctgtaccaagtcgaccttag]

# protein sequence = [MGNRGMEDLIPIVNKLQDAFAQIGIESPIDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLSYANT

..

# ASSANKPSMPSRPVSVAVAPRPQLDNPSVPRRPAPTRPVPSQPPQPARPPPVPSRP]

FASTA:

scaffold1 len=5136627
TATACTACATATGATTTTTTATAGATAAAAAATCATATGTAGTatatttattgcaaaaaaaaactcacatataacatatttatttcaataaaaaactatt
gagtgatttttctgaaatcccccttccagaattgacagtggttttaaatgcatgtcttttactaccctaagctattcaaaaggaaatagcttacaaattt

..

Please let me know if you have any idea how to make the files similar, or any advice on how to make this work.

Thanks in advance!!

rna-seq gff genemodels genemodel

0 answers

No answers yet.

Log in to answer this question.