This is a test version of Biostars. For the public version, visit https://www.biostars.org.
Filtering Augustus GTF based on protein sequence

I have recently run ab initio prediction using Augustus and now want to filter the output (see below). I would like to filter based on the length of the aa sequence, i.e. <30aa is excluded from future work. I intended to just filter using awk, however, I cannot find anything that indicates the size of the predicted protein sequence in any of the fields. Does anyone have any suggestions for filtering this GTF based on the length of the protein sequence?

The columns (fields) contain: 

seqname   source     feature    start   end   score   strand   frame    transcript and gene name

# ----- prediction on sequence number 1 (length = 5210, name = AGND01000115.1:654099-659309(+)) -----
#
# Predicted genes for sequence number 1 on both strands
# start gene g1
AGND01000115.1:654099-659309(+) AUGUSTUS        gene    979     2277    0.76    -       .       g1
AGND01000115.1:654099-659309(+) AUGUSTUS        transcript      979     2277    0.76    -       .       g1.t1
AGND01000115.1:654099-659309(+) AUGUSTUS        stop_codon      979     981     .       -       0       transcript_id "g1.t1"; ge
ne_id "g1";
AGND01000115.1:654099-659309(+) AUGUSTUS        CDS     979     1071    0.99    -       0       transcript_id "g1.t1"; gene_id "g
1";
AGND01000115.1:654099-659309(+) AUGUSTUS        CDS     1120    1859    0.78    -       2       transcript_id "g1.t1"; gene_id "g
1";
AGND01000115.1:654099-659309(+) AUGUSTUS        CDS     1905    2277    0.98    -       0       transcript_id "g1.t1"; gene_id "g
1";
AGND01000115.1:654099-659309(+) AUGUSTUS        start_codon     2275    2277    .       -       0       transcript_id "g1.t1"; ge
ne_id "g1";
# protein sequence = [MPRAHDHFHGRHYHAERATGPVKSLNPTKRYLIADRKPLHAESDAGKESRPSAESPGVAYVWRSRDNRKGRHALVISV
# DPRKHDATKAPRPSNSYHQTLRGILKMFVRYPVWDVSYDVAIVFTIGSIIWVINGFFSWLPVLNPSTKFSDWAGGLTAFIGATVFEFGSILLMLEAVN
# ENRADCFGWAVEESIDGMLHLTHADNCKHAHAHKGTFVKQSSKTLDNNTTESAGNDRMWSWWPTWYELRSHYFFDIGFLACSSQTFGATVFWISGFTA
# LPPILNNLSTPAENGVYWLPQVIGGTGFIVSSTLFMVEVQPRWYIPAPGVLGWHIGLWNLIGAIGFTLCGALGFGITHPGVEYALTLSTFIGSWAFLI
# GSVIQWYESLNKYPIWVDQKIERLGKRKS]
# end gene g1
###
augustus gtf protein sequence awk
• 1,753 views • link
written by jamie.pike jamie.pike

why not extract all protein sequences in a separate fasta file and filter that one on length (using seqkit or such) ?

(it's not straightforward to extract the length info directly from the augustus output)

• 0 views • link
written by lieven.sterck lieven.sterck

You can filter the GFF by the ORF length using agat_sp_filter_by_ORF_size.pl from AGAT

• 0 views • link
written by Juke34 Juke34

0 answers

No answers yet.

Log in to answer this question.

More posts like this