It's quite possible that NCBI staff read this forum, or that someone else has experienced the same problem. However, I agree: NCBI help desk is the best place to ask.
I have a multicast file with unique identifiers ('SUBJECT.1', 'SUBJECT.2' etc) like this: >SUBJECT.1.1:1203-2742(+) AAATTT >SUBJECT.1:354-700(+) CCCGGG >SUBJECT.2:789-2000(+) GGGCCC >SUBJECT.2:2012-2742(+) TTTAAA how would I extract …
I'm running the following command: blastn -query references.fasta -subject reads.fasta -task blastn-short -outfmt "6" -out output.csv I would like to see the ENTIRE subject sequence …
<p>Hi,</p> <p>I use pairwise align to get the following:</p> <pre><code>> alignment <-pairwiseAlignment(pattern = canonical.protein, subject=protein.extracted) > alignment Global PairwiseAlignedFixedSubject (1 of 1) pattern: [448] DDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNEVGV...FMVGRGYLSPDLSKVRSNCPKAMKRLMAE …
<p>hello everyone,</p> <p>I tried to blast my query sequences with my subject sequences in fasta file...i uploaded both my query and subject sequences in fasta …
<p>I blasted a gene sequence against a whole genome and found out that the subject start site:31636628 is higher than the subject stop site:31626793. I …
You might want to send that question to their helpdesk.
This is a bioinformatics Q&A and people here do not necessarily work @NCBI, so I'm not sure why you ask your question here.
It's quite possible that NCBI staff read this forum, or that someone else has experienced the same problem. However, I agree: NCBI help desk is the best place to ask.