This is a test version of Biostars. For the public version, visit https://www.biostars.org.
Problem to run checkm.

Hello, I have several files which contain proteic fasta sequences. Each file correspond to a cluster of genes. 

UniRef90_100.fasta
UniRef90_101.fasta
UniRef90_102.fasta
UniRef90_103.fasta
UniRef90_104.fasta
UniRef90_105.fasta
UniRef90_10.fasta
UniRef90_11.fasta
UniRef90_12.fasta
UniRef90_13.fasta

I want to determine the contamination of each cluster. For that, I want to run checkm . I used checkm lineage_wf bins checkm but it does not work. I get this error message : checkm: error: unrecognized arguments:followed by all my bin files.

My question is : do these files are bins? Each file is compound as the following structure : 

>UniRef90_A0A1B2YXP8 - Cluster: Uncharacterized protein
MRILRNFLGLFLLTAFIFSCVDENESNADFVDTISEPTNISALVSISQDNTGLVTIIPTG
EGVVTFNVDYGDGSDISGSINPGNSTEHFYSEGTYEATIIGTALDGSTAQATVTVVVSFI
APENLVVDILTSSGSYNILVSASADYATSFEVLFGDEAGGDATPMQIGEQLSHSYELAGT
YNVTITALSGGAATTQYSEEITITDPPVFDGFSTFEDFEGEVPGNFSFGGVGNVQVVANP
DNSGINTSTSVMQCTKDQGAEVWGGMGFAVNGHINFNGNNVLRLKSYAPEVGKVVKVKLE
TSAGNVAGLTYEFDMVTTVANQWEILTYDFSGAPDLDYITAIVFYDFGNQNAGVYHFDDV
EVGIGEYIQGIENFEGDVPESFTFGGVGGVEVIPNPDPSGENITGNVLQFVKDEGAEVWG
GMGFAVDVIDFNGASQIHLKSYAPEAGKVVKVKLETSAGNVAGLTHEVDVTTTVANEWET
LIYDFTGAPDLEYVSFIVFYDFGNTVGATYRVDEIQLID
>UniRef90_A0A1B2YXU0 - Cluster: Uncharacterized protein
MKYKILFLSILILFSCNHDNEKLDAIIKEYQNHEGYNYEDYPLGNFSEEYFKAEKEFAES
LLLKLDDIDITKLDENDNISYELLSFVLNDIIAYYDFERFLNPLLSDSGFHSSLVYNVRP
MYNYEQVKNYLNKLNAIPQYVDQYLPLLRKGLEKGVSQPLVIFKGYESTYNDHITKDFES
NYFYSPFNKLPNDISEIQRDSIFVAAKNAIEKSVVPQFIRIKDFFEKEYYKKTRTTIGVS
QTPNGSEFYQNRINYYTTSESYTADEIHQIGLKEVARIKKEMIKIIDELKFKGSFEEFFK
FLRTDEQFYAKTPKELLMYARDISKRADEQLPRFFKTLPRKPYGVAPVPDAIAPKYTGGR
YVGTSKNSTDPGYYWVNTYDLKSRTLYTIPALTVHEAVPGHHLQSALNNELGDSIPRFRR
NLYLSAYGEGWGLYTEFLADEMGIYTTPYEKFGKFTYEMWRACRLVVDTGLHTKGWSKEK
AIDYMSKNTALSLHEVNTEIDRYISWPGQALSYKIGELKIRELRNKAKDQLNDKFDIREF
HEKILEYGTVTLPTLERRINNYIEKKNE
checkm contamination fasta
• 5,948 views • link
updated by Asaf Asaf • written by pablo pablo

It would help to provide a link to the package this program belongs to. Have you checked the in-line help to see if that offers any assistance on what the minimal usage needs to look like?

• 0 views • link
written by GenoMax GenoMax

I checked the documentation about this package and I think I did good ... My files are in the good format and the command line I used looks good.

• 0 views • link
written by pablo pablo

If an answer was helpful, you should upvote it; if the answer resolved your question, you should mark it as accepted. You can accept more than one if they work.
Upvote|Bookmark|Accept

• 0 views • link
written by GenoMax GenoMax

2 answers

If the input is protein you should use -g

Wait, I suspect you wrote bins/* is that right? Can you add the full command line?

• 0 views • link
written by Asaf Asaf

The -g option worked. Thanks. 

--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
  Bin Id                  Marker lineage           # genomes   # markers   # marker sets    0     1    2    3    4    5+   Completeness   Contamination   Strain heterogeneity  
--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
  UniRef90_1           k__Bacteria (UID203)           5449        104            58         4     17   19   13   7    44      95.34           283.45              6.85          
  UniRef90_19          k__Bacteria (UID203)           5449        104            58         7     20   20   12   12   33      91.22           255.84             11.38          
  UniRef90_14         k__Bacteria (UID2570)           433         267           178         61   128   56   13   8    1       79.42           42.78              17.65          
  UniRef90_12          k__Bacteria (UID203)           5449         99            53         24    24   16   7    4    24      69.27           141.02             21.72          
  UniRef90_24          k__Bacteria (UID203)           5449        104            58         23    20   29   10   8    14      67.63           103.59             21.25          
  UniRef90_22          k__Bacteria (UID203)           5449         99            53         35    24   9    6    2    23      62.49

I got this kind of output, it looks bad isn't it?

• 0 views • link
written by pablo pablo

Pretty bad, yeah. Each bin is a few bacteria.

• 0 views • link
written by Asaf Asaf

I only shew you the head of the output. I got some other lineages : 

UniRef90_65      p__Proteobacteria (UID3880)        1495        261           164        188    60   13   0    0    0       27.85            5.12              38.46          
  UniRef90_71        p__Euryarchaeota (UID3)          148         188           125        132    46   10   0    0    0       26.89            4.25              20.00          
  UniRef90_73     f__Rhodobacteraceae (UID3356)        67         615           329        451   164   0    0    0    0       26.65            0.00               0.00          
  UniRef90_7         p__Euryarchaeota (UID3)          148         188           125        133    37   15   2    1    0       24.44            9.74              14.81          
  UniRef90_16          k__Bacteria (UID203)           5449        104            58         69    12   6    5    0    12      24.39           29.06              35.29          
  UniRef90_67      p__Proteobacteria (UID3880)        1495        261           164        195    61   5    0    0    0       24.39
• 0 views • link
written by pablo pablo

Quarters of genomes. Usually people use completeness > 70-80% and contamination < 20%. You might get good bins with 0% completeness so watch for those too.

• 0 views • link
written by Asaf Asaf

You meant "0% contamination" no?

• 0 views • link
written by pablo pablo

No, 0% completeness, checkm can't find the proteins it's looking for but other than that the assembly looks good in term of size and N50.

• 0 views • link
written by Asaf Asaf

Ok I got it. And is there is a file where the output is stored? I can't find it.

• 0 views • link
written by pablo pablo

hello, Do you know how can interpret # genomes and # markers and # marker sets columns ?

• 0 views • link
written by vm.higareda • vm.higareda

I think you should open a new question if you're still struggling, with some more background

• 0 views • link
written by Asaf Asaf

hi! can you post the command that you used to run on bash terminal? :)

• 0 views • link
written by biohacker_tobe • biohacker_tobe

According ti the READme:

By default, CheckM assumes genomes consist of contigs/scaffolds in nucleotide space and that the files to process end with the extension fna.

Example Usage

Assume you have putative genomes in the directory /home/donovan/bins with fa as the file extension and want to store the CheckM results in /home/donovan/checkm. To processes these genomes with 8 threads, simply run:

checkm lineage_wf -t 8 -x fa /home/donovan/bins /home/Donovan/checkm

Did you try to specify ' -x fasta ' ?

• 0 views • link
written by vin.darb vin.darb

Yes I tried but I always get the same results.. I don't understand why

• 0 views • link
written by pablo pablo

I only need to add the -g option to work on proteic sequences.

• 0 views • link
written by pablo pablo

Log in to answer this question.

More posts like this

No similar posts found.