Hi there,
Having some trouble with NCBI's blastdbcmd... I have made the database and can run blastp successfully. I would like to now get some fasta sequences using blastdbcmd. When I run: /PATH/ncbi-blast-2.9.0+/bin/blastdbcmd -entry all -db /PATH/Tgondii_r13 -out reference.fasta
It runs perfectly and generates a file with outputs like this in it:
>TGME49_254250 | organism=Toxoplasma_gondii_ME49 | product=PRELI family protein | location=TGME49_chrIII:1559481-1562916(-) | length=480 | sequence_SO=chromosome | SO=protein_coding
MRLFEKTFVFDSDWETVTSAFWAKYPNELQPHVLRVDTLDVDIDPEKKEFATRRLHSLKYSVPRWMECFFGGSSPVGFGL
EEAYCSLPDKVLHLKSRNYTFASFFRVDEECTYTPDPTDPSRTVYKQTATYKVFGLGAAINRALERAAVRSAEEKSSVGF
SVVQSRASSLEQQGWWGRQCAACIHSLETAAASATQHYRDLVKNLEESLHLSLSPSSPLSSPLSLERLSPSPLVESSLFA
ACAMSASAKRFLSRPSPPFVLSRNDSSSLFSLNLPFGPLSLPSLPSSLKAFLPPSSSSPSSSSSPSSPPSPSSLSLSVNA
SPPERGVFRSSGDVDCFCLRPSPGGLLPRSTLEWNRTWREERENASRRRAAIRNDSAVSSTPEEEEGPRRTDSGSSTHGA
Now i am trying to search the command:
/Users/PATH/ncbi-blast-2.9.0+/bin/blastdbcmd -entry TGME49_254250 -db /Users/PATH/Tgondii_r13 -out TGME49_254250.fasta
It flashes up the error: Error: [blastdbcmd] Entry not found: TGME49_254250 Error: [blastdbcmd] Entry or entries not found in BLAST database
Not sure what to do! Thank you in advance for any help!
Oh of course I completely forgot that! Thank you so much. Solved my problem :)
Great, I've moved the post to an answer so you can accept it and provide closure to the thread :)