This is a test version of Biostars. For the public version, visit https://www.biostars.org.
SignalP, prop, secretomeP

Hello

I am trying to run the prop program with the test file (./prop -g -s test/GDNF_HUMAN.fsa) but my output file is not the same as the output file of the test. It seems that even though I linked the Signalp program to prop the program is not using it. In the same way when I run secretomep the output files (NN score) comes out different compared to the test output file and I do not know if the same error is linked. What I can do. It goes both output files:

 programas_secretoma/prop-1.0c$./prop -s test/GDNF_HUMAN.fsa

ProP v.1.0b ProPeptide Cleavage Site Prediction #####

Furin-type cleavage site prediction (Arginine/Lysine residues) #####

211 GDNF_HUMAN
MKLWDVVAVCLVLLHTASAFPLPAGKRPPEAPAEDRSLGRRRAPFALSSDSNMPEDYPDQFDDVMDFIQATIKRLKRSPD 80 KQMAVLPRRERNRQAAAANPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYDKIL 160 KNLSRNRRLVSDKVGQACCRPIAFDDDLSFLDDNLVYHILRKHSAKRCGCI 240 ............................................................................P... 80 ................................................................................ 160 .......P........................................... 240

Signal peptide cleavage site predicted: none

Propeptide cleavage sites predicted: Arg(R)/Lys(K): 2

programas_secretoma/prop-1.0c$ less test/four.out

211 GDNF_HUMAN
MKLWDVVAVCLVLLHTASAFPLPAGKRPPEAPAEDRSLGRRRAPFALSSDSNMPEDYPDQFDDVMDFIQATIKRLKRSPD 80 KQMAVLPRRERNRQAAAANPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYDKIL 160 KNLSRNRRLVSDKVGQACCRPIAFDDDLSFLDDNLVYHILRKHSAKRCGCI 240 sssssssssssssssssss.........................................................P... 80 ................................................................................ 160 .......P........................................... 240

Signal peptide cleavage site predicted: between pos. 19 and 20: ASA-FP

Propeptide cleavage sites predicted: Arg(R)/Lys(K): 2

software error

0 answers

No answers yet.

Log in to answer this question.