Hi, thanks for you help. How could i run bedtools geftasta with a cds entrie? I cannot find this argument on the commande line?
Hi all, I'm actually using bedtools to extracte my cds in fasta format from a gff3 file.
The command is : bedtools getfasta -fi scaf0_test.fa -bed run_augustus_0035.gff.out -fo fasta.out -s
But the problem is that it gives me not only the coding part (without stop codon inside but also the non-coding part)
For exemple, here is my protein sequence from de gff file:
MIAALVPREPPVGPPGRRAEGRGGIHCDATNNHTYTSPHIHSRHVHAVADRMSTLGKNLIGAPWRGVTTRGTTVSSVL
RAILQDSDKPESEHSGHACEQCGKLYKTVRTLYSHIMLKHPKDKEEVQCSVCDKKYSSALSLQKHVRYMHRYEHRCK
TCYRTFATSEMLVCHRESCYNNVSPCPVCNKIFDSRLALRNHINYNHPRSEESSVQERRQCNVCSRMFTSSRSLLNHM
AAIHPVGTTDCNLCGRTFNSMPAFRSHFLYKHGDHGVHCTKCHKLFATDTSLRRHMEKVHGKNNKPGFLCGICQTYFYK
SSDLVQHILANHKETSSD
And here is my dna sequence comming from the outfile (traducted):
MIAALVPREPPVGPPGRRAEGRGGIHCDATNNHTYTSPHIHSRHVHAVADRMSTLGKNLIGAPWRGVTTRGTTVR*YVTNTG
VDSEEIKDRSCKHLQYRAPLYARA*FALIRHCADATTLPNITAFGIVTLPV**YKIN*THYCGVICAQS*TALHVMTC*RDECFRFQI
RRSLTLITMVVLIIMRTPRTIYT*TNPRNHILSP*SLRCFLTYIHVYKIYKNRSRTIRRGQVRSQYIECYIYTL*HPCLQSLSNCMRQ
YLCYRSQKQVCIFIEDPACLSETAIFRIRCKRKRHIFTQIFTSNLLNLPTLKFQRNKYPFKFIYF**ISTNLFNCKLSTKISCKKKEIF
FSSSSFFFSTDIYQLRRVCTYITENETRKDVNIINTLQNEC*NRYC*YRSKHSSVGN*YR*GTFAFFQFRIARHSTRLRQTGERA
FRARL*AMRQTL*NSEDALFAYHAETPQR*RGGAVFRLR*KVLVGTESTETRALHAPL*APM*NVLQDFCNV*NASLSQGKLLQ
QRVPMPRVQQDI*LPTCTSESYKL*SSKK*RKFGSRKEAMQRL*PHVY*FS*PPQPHGGYTPGRHD*LQFVRPHF*FHASLSKP
FPLQAR*PRRTLHKVS*IIRNRYKSSPAHGESTRQK**TRFLVRYMPNLFL*IE*PGAAHIGKP*GDIE*L
As you can see, there are a lot of stop codon, do you know why I do not get the exact same protein sequence? The fasta dna sequence should contain two cds concatened (one with 74 bases and the other should have 256), then the total length of this sequence should be 330.
Here is an exemple of my gff file:
# gffread v0.9.9
##gff-version 3
scaffold_0 AUGUSTUS mRNA 42655 44668 . - . ID=g1.t1;geneID=g1
scaffold_0 AUGUSTUS CDS 42655 43423 0.94 - 1 Parent=g1.t1
scaffold_0 AUGUSTUS CDS 44445 44668 0.82 - 0 Parent=g1.t1
scaffold_0 AUGUSTUS mRNA 51102 55274 . + . ID=g2.t1;geneID=g2
scaffold_0 AUGUSTUS CDS 51102 51192 0.60 + 0 Parent=g2.t1
scaffold_0 AUGUSTUS CDS 51310 51528 0.80 + 2 Parent=g2.t1
scaffold_0 AUGUSTUS CDS 52816 52845 0.64 + 2 Parent=g2.t1
scaffold_0 AUGUSTUS CDS 53114 53223 0.50 + 2 Parent=g2.t1
scaffold_0 AUGUSTUS CDS 53333 53633 0.91 + 0 Parent=g2.t1
scaffold_0 AUGUSTUS CDS 53981 54296 0.64 + 2 Parent=g2.t1
scaffold_0 AUGUSTUS CDS 54559 54581 0.94 + 1 Parent=g2.t1
scaffold_0 AUGUSTUS CDS 54783 54975 0.89 + 2 Parent=g2.t1
scaffold_0 AUGUSTUS CDS 55184 55274 0.66 + 1 Parent=g2.t1
1 answer
I think that bedtools getfasta will not parse your gff3 file based on [cds -> mRNA] relationship. Therefore you get either the sequence cds by cds, or from start to end of the mRNA (including introns). The frame shift caused by the introns would explain the number of stop codons you find.
This would make sense based on the example you provide:
Length of g1.t1 first intron = 44668-44445 = 223
number of a.a encode in the first intron = 223/3 ~= 74
number of consequently matching a.a bewteen theoretical sequence and the outfile = 75 a.a
( MIAALVPREPPVGPPGRRAEGRGGIHCDATNNHTYTSPHIHSRHVHAVADRMSTLGKNLIGAPWRGVTTRGTTV )
A solution would be to run bedtools getfasta your cds entries only, then to merge them by ID.
As @Carlo said you will have to get CDS entries individually and then merge them for individual ID's. But the easier option would likely be using the gffread utility that was posted above by @jean.elbers.
just create the file yourself. Something like:
awk '$3 == "CDS" {print $0}' run_augustus_0035.gff.out > run_augustus_0035_cds_only.gff
Thanks you, it works now but now I have another issue beacause it works well for my sequences starting by ATG (0 reading frame), but when I have a CDS which has a reading frame 1 or 2, my sequences are not in the good reading frame and I have to delete 2 or 1 base for each sequence. Does someone have an idea how I could from my gff file, see the readind frame and if it is 1, delete one base or 2 delete 2 bases to get the correct amino acide sequence when I translate the dna sequence?
You need to merge the DNA sequence of your cds before translating it, it will fix the reading phase problem.
Log in to answer this question.
Have you tried gffread - part of gff utilities (http://ccb.jhu.edu/software/stringtie/gff.shtml)?
Hi, thanks for you help. How could i run bedtools geftasta with a cds entrie? I cannot find this argument on the commande line?
Please use
ADD COMMENT/ADD REPLYwhen responding to existing posts to keep threads logically organized.Ok, it is done, thank you.