More posts like this
-
linear pangenome for crops
written by Bushra BibiDear all, Can you please guide how can I construct linear pangenome for a plant that can be used as a reference genome for variant …
-
Web server/tool for structural motif prediction on multiple proteins?
written by pl559 •I have a list of around 300 protein PDB IDs, and I want to identify structural motifs in the set of proteins by finding the …
-
Motif search in protein list
written by florian.roehrig •Dear all, I have several lists of proteins from mass spec (interactome data). The question I have to answer now, is: share these proteins common …
-
Iupred in batch mode + parser
written by paul.DE-BOISSIER •Hello everyone, I have to deal with IUPred. I have a big dataset to analyse and I'd like to know if it exists some tools …
-
Protein semi-global alignment tools? Blast for glocal alignments?
written by chaperoneline •I would like to compare between a set A of protein sequences (about 400 proteins) and another set B of protein sequences (about 3000 proteins). …
-
scoring matrices computation from transition probability matrix
written by RT!37 •The transition probability matrix over time t is computed as P(t) = e ^Qt. In order to calculate a general set of transition probability matrices …
-
How can I use BALIBASE as a benchmark (on line)
written by sallyzaki70 •Earlier I asked a question of how i compare between(clustal/t-coffee/muscle) https://www.biostars.org/p/297397/ my work will be on line <br> 1-i used the data set >seq0 FQTWEEFSRAAEKLYLADPMKVRVVLKYRHVDGNLCIKVTDDLVCLVYRTDQAQDVKKIEKF …
-
Multiple sequence alignment (MSA) of proteins using specific matrix
written by RT!37 •I am willing to do MSA for a set of proteins using a specific scoring matrix . There are tools like clustalW, Muscle where one …
-
resource for structural class of proteins
written by RT!37 •Is there any resource from which structural class of proteins using their uniprot ids can be retrieved????
-
Good Multiple Sequence Alignment Tool For Ordered/Disordered Proteins
written by miquelduranfrigola<p>Hi all,</p> <p>I'm dealing with a protein that has both ordered and disordered regions (most of it is disordered). I need to align this protein …