What is "^A" in NR database?

I have download the NR database from http://www.matrixscience.com/help/seq_db_setup_nr_gi.html And I less the file I have download.

>gi|66816243|ref|XP_642131.1| hypothetical protein DDB_G0277827 [Dictyostelium discoideum AX4]^Agi|1705556|sp|P54670.1|CAF1_DICDI RecName: Full=Calfumirin-1; Short=CAF-1^Agi|793761|dbj|BAA06266.1| calfumirin-1 [Dictyostelium discoideum AX2]^Agi|60470106|gb|EAL68086.1| hypothetical protein DDB_G0277827 [Dictyostelium discoideum AX4]
MASTQNIVEEVQKMLDTYDTNKDGEITKAEAVEYFKGKKAFNPERSAIYLFQVYDKDNDGKITIKELAGDIDFDKALKEY
KEKQAKSKQQEAEVEEDIEAFILRHNKDDNTDITKDELIQGFKETGAKDPEKSANFILTEMDTNKDGTITVKELRVYYQK
VQKLLNPDQ

What is "^A".

If I format database by BLAST, will it influences?

rna-seq

• 1,758 views • link

updated 9.7 years ago by Damian Kao

• written 9.7 years ago by felix.kuo.1211 •

1 answer

The website where you downloaded this from says:

If an entry in nr represents multiple source database entries, the Fasta title lines are concatenated together with CTRL+A as the delimiter.

^A is same as CTRL+A. I don't think it will influence making a blast database as I think they use the same type of delimiter.

• 0 views • link

written 9.7 years ago by Damian Kao