This is a test version of Biostars. For the public version, visit https://www.biostars.org.
Finding SNPs and Haplotypes ?

I have the following alignment file. How can I identify the SNP sites and how can I find the haplotypes. I know these are related but can't seem to apply it to the below data. Any help would be appreciate. If anyone can show me an example with just one of the rows or columns, that would be enough for me to figure out the rest.Thanks !

CLUSTAL W (1.81) multiple sequence alignment


seq1    gctgcatcagaagaggccatcaagcgcatcactgtacttctgccatggcc

Seq2    gctgtatcagaacaggccatcaagcgcatcactgtacttctgccatggcc

Seq3    gctgtatcagaacaggccatcaagcacctcactgtacttctgccatggac

Seq4    gctgcatcagaagaggccatcaagcacatcactgtccttctgccatggcc

Seq5    gctgcatcagaagaggccatcaagcacatcactgtccttctgccatggcc

Seq6    gctgtatcagaacaggccatcaagcgcatcactgtccttctgccatggcc

Seq7    gcggcatcagaagaggcgatcaagcacatcactgtccttctgccatggac

Seq8    gctgcatcagaagaggccatcaagcacatcactctacttctgccatggcc

Seq9    gctgtatcagaacaggccatcaagcgcatcactgtccttctgccatggcc

Seq10   gctgcatcagaagaggccatcaagcgcatcactctccttctgccatggcc

        ** * ******* **** ******* * ***** * ************ *
rna-seq snp haplotype alignment sequencing
• 2,456 views • link
written by reeki • reeki

0 answers

No answers yet.

Log in to answer this question.

More posts like this
  • Remove redundant nucleotide sequences in a FASTA file containing ambiguous N
    written by wang9ting • wang9ting
    Is there any tool for removing redundant sequences in the scenario where "N" stands for A or C or G or T? For example: ``` …
  • how to sort protein and nucleotide sequences based on IDs
    written by Kay • Kay
    I have a protein alignment file in fasta format and nucleotide sequences of the original proteins. How can I sort my nucleotide sequences such that …
  • extract several fasta file with a list of ID (in order)
    written by Chvatil Chvatil
    I have a file with several names such : seq1 seq9 seq3 seq7 seq5 seqi seqn.... and another fasta file with all my sequences, and …
  • compare 2 dataframe with pandas
    written by Chvatil Chvatil
    It is the first time I use pandas and I do not really know how to deal with my problematic. In fact I have 2 …
  • sort FASTA file into table
    written by a.bolbukova.12 • a.bolbukova.12
    My fasta file looks like this >seq0 FQTWEEFSRAAEKLYLADPMKVRVVLKYRHVDGNLCIKVTDDLVCLVYRTDQAQDVKKIEKF >seq1 KYRTWEEFTRAAEKLYQADPMKVRVVLKYRHCDGNLCIKVTDDVVCLLYRTDQAQDVKKIEKFHSQLMRLME LKVTDNKECLKFKTDQAQEAKKMEKLNNIFFTLM >seq2 EEYQTWEEFARAAEKLYLTDPMKVRVVLKYRHCDGNLCMKVTDDAVCLQYKTDQAQDVKKVEKLHGK >seq3 MYQVWEEFSRAVEKLYLTDPMKVRVVLKYRHCDGNLCIKVTDNSVCLQYKTDQAQDVK >seq4 EEFSRAVEKLYLTDPMKVRVVLKYRHCDGNLCIKVTDNSVVSYEMRLFGVQKDNFALEHSLL >seq5 SWEEFAKAAEVLYLEDPMKCRMCTKYRHVDHKLVVKLTDNHTVLKYVTDMAQDVKKIEKLTTLLMR >seq6 FTNWEEFAKAAERLHSANPEKCRFVTKYNHTKGELVLKLTDDVVCLQYSTNQLQDVKKLEKLSSTLLRSI >seq7 SWEEFVERSVQLFRGDPNATRYVMKYRHCEGKLVLKVTDDRECLKFKTDQAQDAKKMEKLNNIFF >seq8 SWDEFVDRSVQLFRADPESTRYVMKYRHCDGKLVLKVTDNKECLKFKTDQAQEAKKMEKLNNIFFTLM …
  • How can I use BALIBASE as a benchmark (on line)
    written by sallyzaki70 • sallyzaki70
    Earlier I asked a question of how i compare between(clustal/t-coffee/muscle) https://www.biostars.org/p/297397/ my work will be on line <br> 1-i used the data set >seq0 FQTWEEFSRAAEKLYLADPMKVRVVLKYRHVDGNLCIKVTDDLVCLVYRTDQAQDVKKIEKF …
  • Remove Duplicate Reads from paired end data set
    written by Tonor Tonor
    I would like to remove duplicates from a paired end ngs data set (illumina). This is an environmental sample, so no host to map to …
  • compare fasta files by sequence
    written by Chris • Chris
    Hi, I have two fasta files with differetn headers. Sequences in file 2 partially match sequences in file1 I want to have a one-liner that …
  • Cant find Clustalw.exe through Bioperl
    written by Andrea • Andrea
    Hello everyone.I m trying to run the script below. but I get the error: ------------- EXCEPTION ------------- MSG: Cannot find executable for clustalw. path="clustalw.exe" STACK …
  • Constucting a Tree using Bioperl
    written by Andrea • Andrea
    ### Constucting a Tree Hi everyone! I'm trying to construct a tree and get its newick format: **outfile.fasta** ``` >seq9 ---KNWEDFEIAAENMYMANPQNCRYTMKYVHSKGHILLKMSDNVKCVQYRAENMPDLKK ----------------------------------------------- >seq7 ----SWEEFVERSVQLFRGDPNATRYVMKYRHCEGKLVLKVTDDRECLKFKTDQAQDAKK MEKLNNIFF-------------------------------------- …