This is a test version of Biostars. For the public version, visit https://www.biostars.org.
Using hhblits against ncbi nr database

I am using the software hhsuite from Dr. Soeding (http://toolkit.tuebingen.mpg.de/hhblits) for my research projects. I have a very specific question regarding the output it generates, inputs from anybody who has used the software will help greatly.

For a query to search the nr20 database using hhblits, the output .hhr file outputs the hits against clusters of proteins hits in the database. How can I get the profile-profile similarity score for each protein within each cluster to get an ordering of the proteins that are closer homologs to the query?

For example (please refer to hhblits output below): For cluster NR20|XULHUQABA, the database a3m file (nr20_xxx_a3m_db has 17 proteins. The output .hhr file contains only a single profile alignment against the consensus sequence of NR20|XULHUQABA (profile-profile similarity score is 1233.89). The other hits are for other clusters.

How can we get all the pairwise profile-profile scores of our query sequence against all 17 proteins in cluster NR20|XULHUQABA?

Thanks

Example output from running hhblits server (http://toolkit.lmb.uni-muenchen.de/hhblits/results/5323588):

Query Acetylcholine_receptor_protein_delta_chain_Torpedo_californica (seq=MGNIHFVYLL...DYSSDHPRCA Len=522 Neff=1.0 Nseqs=1)
Parameters  search:local realign with MAC:yes MAC threshold=0.35 
   No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 NR20|XULHUQABA|16|534 Neuronal 100.0  3E-166  4E-171 1233.9   0.0  496   16-520    35-532 (534)
  2 NR20|GODXONABE|128|541 Acetylc 100.0  8E-164  1E-168 1219.9   0.0  493   10-521    30-524 (541)
  3 NR20|XOZLIBEBA|11|444 Chain C, 100.0  8E-138  8E-143 1014.5   0.0  388   18-521    54-443 (444)
  4 NR20|SANVERABE|40|532 Acetylch 100.0  4E-116  5E-121  876.3   0.0  463   18-516    46-529 (532)
  5 NR20|GUTVEBEBA|2|417 PREDICTED 100.0  5E-111  4E-116  812.4   0.0  401  110-521     1-416 (417)
  6 NR20|YIXVUYEBA|4|248 Chain B,  100.0  2E-106  2E-111  750.6   0.0  247  246-504     1-247 (248)
..

Followed by profile alignments, one per cluster:

>NR20|XULHUQABA|16|534 Neuronal acetylcholine receptor subunit alpha-3; Acetylcholine receptor subunit
  epsilon; Neuronal acetylcholine receptor subunit eat-2; Neuronal acetylcholine receptor subunit alpha-2;
  Flags: Precursor; Neuronal acetylcholine receptor subunit beta-2. [Xenopus laevis]|148227704 [Equus caballus
  |194217616 [Ciona intestinalis]|198429844|320089451|198429842|320089453 [Meleagris gallopavo]|326926016
  [Taeniopygia guttata]|224060672 [Torpedinoidei]|113101|64394|39653647|39653655|39653653 [Canis lupus
  familiaris]|73994148 [Danio rerio]|122890898 [Takifugu rubripes]|31559081.
    Probab=100.00  E-value=3.4e-166  Score=1233.89  Aligned_cols=496  Identities=54%  Similarity=0.949  Sum_probs=465.1
  Q Acetylcholine_   16 YSGCSGVNEEERLINDLLIVNKYNKHVRPVKHNNEVVNIALSLTLSNLISLKETDETLTSNVWMDHAWYDHRLTWNASEY   95 (522)
  Q Consensus        16 ysgcsgvneeerlindllivnkynkhvrpvkhnnevvnialsltlsnlislketdetltsnvwmdhawydhrltwnasey   95 (522)
                        -+|-.+.|||+|||++|+  +.|||.+||++|-++.|..-+.|||+|||||+|.+||+|+||||+++|-|.||.||.|+|
  T Consensus        35 l~~~~~~n~E~rLi~~Lf--~~Yn~~vRP~~~~d~kv~V~v~lTLtnLISLnEkeE~ltTnVwie~~W~DyRl~Wn~s~y  112 (534)
  T NR20|XULHUQABA   35 LDLSVRSNEEGRLISYLF--EGYNKRVRPARKKDDKVDVSVKLTLTNLISLNEKEETLTTNVWIEIQWTDYRLSWNPSEY  112 (534)
  Confidence            344444699999999987  569999999999999999999999999999999999999999999999999999999999
..
hhsearch hhblits protein homology

0 answers

No answers yet.

Log in to answer this question.