Hi,

I have a python script that allows me to extract the locus_tag info from a genbank file but I cant seem to get it to work for also getting the old_locus_tag info (which has the original gene names used in all current publications.

Here's my script;

#!/usr/bin/env python

import sys
from Bio import SeqIO

if len(sys.argv) is not 4:
    sys.exit("usage:  genbank_extract_gene.py <type: nucleotide/protein> <in genbank> <out parsed file>")

in_type = sys.argv[1]
if in_type not in ("protein", "nucleotide"):
    sys.exit("usage:  genbank_extract_gene.py <type: nucleotide/protein> <in genbank> <out parsed file>")

in_genbank = open(sys.argv[2], 'r')
out_fasta = open(sys.argv[3], 'w')

# use parse() method for genbanks with more than one genbank record, will work with just one too   
full_record = SeqIO.parse(in_genbank, "genbank")
for seq_record in full_record:  
    contig = seq_record.id
    strain = seq_record.annotations['source'].split(' ')[2]
    #print strain
    for feature in seq_record.features:

        if in_type == "nucleotide":

            # for nucleotide
            if feature.type == "gene":
                locus_tag = feature.qualifiers.get('locus_tag')[0]
                #print locus_tag
                start = feature.location.start
                end = feature.location.end    

                # reverse and complement if needed
                if feature.strand is 1:
                    nt_seq = seq_record.seq[start:end]
                else:
                    nt_seq = seq_record.seq[start:end].reverse_complement()

                if feature.qualifiers.get('gene'):
                    gene = feature.qualifiers.get('gene')[0]
                    #print gene
                    out_fasta.write(">{0}_{1}\n{2}\n".format(locus_tag, gene, nt_seq))
                else:
                    out_fasta.write(">{0}\n{1}\n".format(locus_tag, nt_seq)) 

        elif in_type == "protein":
            # for amino acid
            if feature.type == "CDS":
                locus_tag = feature.qualifiers.get('locus_tag')[0]


                translation = feature.qualifiers.get('translation')[0]
                out_fasta.write(">{0}\n{1}\n".format(locus_tag, translation))


in_genbank.close()
out_fasta.close()

and example of my genbank file;

FEATURES             Location/Qualifiers
     source          1..2158758
                     /organism="Coxiella burnetii Dugway 5J108-111"
                     /mol_type="genomic DNA"
                     /strain="Dugway 5J108-111"
                     /db_xref="taxon:434922"
     gene            complement(6..119)
                     /locus_tag="CBUD_RS00005"
     CDS             complement(6..119)
                     /locus_tag="CBUD_RS00005"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005769930.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_005769930.1"
                     /db_xref="GI:492172326"
                     /translation="MEFVRHLFYLAVDNLSRVERKEIKVLIVHIFIELALE"
     gene            140..1495
                     /gene="dnaA"
                     /locus_tag="CBUD_RS00010"
                     /old_locus_tag="CBUD_0001"
                     /locus_tag_other="COXBU7E912_0001"
     CDS             140..1495
                     /gene="dnaA"
                     /locus_tag="CBUD_RS00010"
                     /old_locus_tag="CBUD_0001"
                     /locus_tag_other="COXBU7E912_0001"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q83FD8.1"
                     /note="binds to the dnaA-box as an ATP-bound complex at
                     the origin of replication during the initiation of
                     chromosomal replication; can also affect transcription of
                     multiple genes including itself; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chromosomal replication initiator protein DnaA"
                     /protein_id="WP_005769932.1"

Thanks in advance

Cheers
Paul