Hi,

I'm running HHblits with sequences (one by one) from SCOP 1.75 (ASTRAL 70% subset) against SCOP70 database. I got errors with many domains. For example, when I searched this database with domain d1idra_ with sequence:

>d1idra_ a.1.1.1 (A:) Protozoan/bacterial hemoglobin {Mycobacterium tuberculosis, HbN [TaxId: 1773]}
gllsrlrkrepisiydkiggheaievvvedfyvrvladdqlsaffsgtnmsrlkgkqvef
faaalggpepytgapmkqvhqgrgitmhhfslvaghladaltaagvpsetiteilgviap
lavdvts

I got error:

Error in hhblits: could not open file 'g1pyo.1.hhm'

This problem appeared with many sequences, approx. one third of ASTRAL 70% subset. Another two thirds of sequences produced some results.

Is there any problem in SCOP70 database? Am I doing something wrong?

Thank you a lot for your help!