This is a test version of Biostars. For the public version, visit https://www.biostars.org.
etetoolkit, Visualization of phylogenetic trees

Hello!

I'm trying to adapt an example of Visualization of phylogenetic trees. Unfortunately it fails on line recon_tree, events = genetree.reconcile(sptree) with The following species are not contained in the species tree: ARA,THE'. And indeed, there are no "ARA" ant "THE" species defined.

However the script is able to generate both genetree and sptree.

I don't understand where this error comes from(second day with python) there is of course no "ARA" and "THE" species in the tree.

Thank you!

The whole code is:

from ete2 import PhyloTree, TreeStyle

alg = """
 >SOLTU_M1A5X1
 MASRRLIASLLRSSAQRGAGSGGGPISRSSIANSIARPASRASPKGFLLNRAVQYATSAAAPASKPS
 >ARATH_Q9C5A9
 MASRRILSSLLRSSSSRSTSK-SSLIGSRNPRLLSPGPAHGAAPCGTLLGRVAEYSTSSPANSAAPS
 >THELL_Tp6g34190
 MASRRVLSSLLRSSSGRSAA----KFGSRNPRLSSPSPARRAAPFGDLLGRVAEYSTSSPANSAASS
 >PHYPA_A9T281
 MSGRKALAAALRAGSRRLSSSPQPPKGARSFSPN--------ASNGRAVANAAAKGLSRSIFNSARA
 >ORYSJ_Q0DG48
 MATRRALSSLVRAASRLR-GA--------SPAPRPRGPLHRPSPSGYLFNRAAAYATAAAAKEAAPP
 >BRADI_I1HQG7
 MATRRAISSIVRSASRIR-AA--------SPSPLPRAPLHRPSPAGFLLNRAAAYATSAAAQAAPAT
"""

def get_example_tree():
    # Performs a tree reconciliation analysis
    gene_tree_nw = '(PHYPA_A9T28,((ARATH_Q9C5A9,THELL_Tp6g34190)((ORYSJ_Q0DG48,BRADI_I1HQG7),SOLTU_M1A5X1)));'
    species_tree_nw = "((SELML, PHYPA), ((ORYSJ, BRADI), (SOLTU, (ARATH, THELL))));"
    genetree = PhyloTree(gene_tree_nw)
    sptree = PhyloTree(species_tree_nw)
    recon_tree, events = genetree.reconcile(sptree)
    recon_tree.link_to_alignment(alg)
    return recon_tree, TreeStyle()

if __name__ == "__main__":
    # Visualize the reconciled tree
    t, ts = get_example_tree()
    t.show(tree_style=ts)
    #recon_tree.render("phylotree.png", w=750)
ete python phylogeny ete2

1 answer

PhyloTree instances are prepared to extract species names/codes directly from the sequence name. By default, the rule is to use the first three letters as species code.

In your example, you just need to modify such rule to extract species name by splitting seq. names at the first underscore:

def get_spcode(nodename):
  return nodename.split("_")[0]
genetree = PhyloTree(gene_tree_nw, sp_naming_function=get_spcode)

The same should be done with the reference species tree. For instance, if it only contains plain species names:

def get_spcode2(nodename):
  return nodename 
sptree = PhyloTree(species_tree_nw, sp_naming_function=get_spcode2)

This is documented in more detail at http://pythonhosted.org/ete2/tutorial/tutorial_phylogeny.html#automatic-and-custom-control-of-the-species-info

Log in to answer this question.