This is a test version of Biostars. For the public version, visit https://www.biostars.org.
Computational Time for obspectrophore in Open Babel?

I apologize in advance if this question is naive/simple. I am currently running the Open Babel command obspectrophore as follows:

obspectrophore -i tester.sdf

where tester.sdf is an SDF file generated from the following FASTA sequence:

MDAATTRVGLTDLTFRLLRESFADAVSWVAKNLPARPAVPVLSGVLLTGSDNGLTISGFDYEVSAEAQVG

Running the command above took 5+ minutes to complete. Is this normal or is there some way (using a different file format/modifying settings) that I can obtain faster spectrophore results?

Thanks in advance!

feature extraction spectrophore open babel
• 2,036 views • link
updated by Biostar Biostar • written by dxu108 • dxu108

"On a personal computer equipped with an i7-5500U processor with 12 GB of main memory, the Open Babel version runs fastest, with an average calculation speed of 36 ± 2 ms/molecule." https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5842169/ This is most likely the speed with small molecule not large ones.

• 0 views • link
written by db4 • db4

0 answers

No answers yet.

Log in to answer this question.

More posts like this
  • GATK BwaSpark parameter optimisation
    written by Joshua • Joshua
    Hi, I'm running GATK version: 4.1.2.0 I'm trying to validate the performance of BwaSpark. The input ubam file size is 5.1 GB. It takes around …
  • Problems with sdf to pdb file conversion
    written by mlovelace713 • mlovelace713
    Hello, my name is Matthew Lovelace, I am a highschooler and for one of my classes I am working on a project that uses Autodock …
  • how to get reports of prinseq lite after running the prinseq-lite ?
    written by dramitr.sahu • dramitr.sahu
    Hi all, i am running the command to trim my fastq sequence. my command is " perl prinseq-lite.pl test.fastq -out_format 5 -min_len 50 -mean_qual_score 25 …
  • RepeatMasker -> file *.fa.log
    written by Sarah • Sarah
    Hello, After running RepeatMasker I obtain in the file.fa.log file: `No. words: 1200; after pruning: 908` This is my command line: perl RepeatMasker -engine crossmatch …
  • Unextractible Embl Features For Seqio.Parse
    written by blaise.li • blaise.li
    <p>I would like to extract information from some of the "SO_feature" features of the following file: <a href='https://raw.github.com/cbergman/transposons/master/current/transposon_sequence_set.embl.txt'>https://raw.github.com/cbergman/transposons/master/current/transposon_sequence_set.embl.txt</a></p> <p>Is it normal that when I parse …
  • Expect Library - Bam-Readcount
    written by tayebwajb tayebwajb
    <p>I have installed <a href='http://samtools.sourceforge.net/SAM1.pdf'>bam</a>-readcount using <code>git clone --recursive</code> as per the instructions on github. </p> <p>I am now using the command below to obtain …
  • How To Reorder Bam File Contigs For The Gatk Pipeline
    written by win win
    <p>i have a sorted &amp; read group added bam file and when i try to run the following GATK command on it</p> <pre><code>java -jar GenomeAnalysisTK.jar …
  • Genome Music Bam-List
    written by will.lockwood • will.lockwood
    <p>Hi All, </p> <p>I apologize in advance if this is a stupid question. I am not very computer literate so this program has been difficult …
  • Subsampling Genomic Space
    written by Alex Reynolds Alex Reynolds
    <p>Let's say I have a BED file that defines my genomic space as follows:</p> <pre><code>chrN a1 b1 chrN a2 b2 ... </code></pre> <p>I would like …
  • Problem Running Blast Jobs.
    written by Anjan Anjan
    <p>I started to run blast, locally on my machine, on 4 files with 1323, 210, 501, 166 fasta sequences each.</p> <p>For all jobs except the …